DNA translocase FtsK (ftsK) Recombinant Protein | ftsK recombinant protein
Recombinant DNA translocase FtsK (ftsK)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA translocase FtsK (ftsK); Recombinant DNA translocase FtsK (ftsK); ftsK recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-743aa; full length protein
Sequence
MAKKKKQKTIKLDAEIKGILFITIGVLSLISIMSSSNSGIIGKMSKKILVFIFGLGAFIF PFFIIFVGVCLILKKGKVTYSGKFYGIVLFILNTLFCLHIGDIVTKGLDRSFFQGIVDIY NSETFLHGGVISYIVDLPLYKLFGKWGTFVIFISIYVICFILISQISLYSIISKFKLKKE KRRKEKNIEIKEDVQDEVKFTEIKDSEEIPEEKIINRIKIIDFIKNTNIEENDDTKENKP IQKGKDSNNIQGEKDINKELEEEMSKAALKTIDYEFPSIDLLNDNKSIKLKKEDKKELLN NANKLEETLTSFGVEAKVTQVTKGPSVTRFELQPSVGVKVSKIVHLADDIALNLAAQDVR IEAPIPGKSAVGIEVPNRELTPVYLKEVLDSNEFKNCNKNLAFAIGKDIAGNCVVSDLSK MPHLLIAGATGSGKSVCINTLIISLIYKYSPEDVKLLMVDPKVVELNIYNDIPHLLIPVV TEPKKAAGALYWAVNEMTRRYKLFAETNVRNIESYNELLKKGKGVEKLPLIVIVIDELAD LMMVCPNDIEDYIGRLAQMARAAGMHLVIATQRPSVDVITGVIKANIPSRISFAVSSQID SRTILDMGGAEKLLGKGDMLFYPSGESKPMRVQGAFISEEEVEKVVGFIKEKQCGEVEYE DSIIDEINTSIEINNEDRDELLEEAIKIVVDVDQASTSLLQRKLRIGYNRAARIMDQMEE RGIISQKDGSKPRQVLISKDDIV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Clostridium tetani
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ftsK recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83,169 Da
NCBI Official Full Name
cell division protein FtsK
NCBI Official Symbol
CTC_RS06590
NCBI Protein Information
cell division protein FtsK
UniProt Protein Name
DNA translocase FtsK
Protein Family
UniProt Gene Name
ftsK
UniProt Entry Name
FTSK_CLOTE
Uniprot Description
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in assembly of the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, which is located within the replication terminus region. Required for activation of the Xer recombinase, allowing activation of chromosome unlinking by recombination ().
Similar Products
Product Notes
The ftsK ftsk (Catalog #AAA7015310) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-743aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ftsK ftsk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAKKKKQKTI KLDAEIKGIL FITIGVLSLI SIMSSSNSGI IGKMSKKILV FIFGLGAFIF PFFIIFVGVC LILKKGKVTY SGKFYGIVLF ILNTLFCLHI GDIVTKGLDR SFFQGIVDIY NSETFLHGGV ISYIVDLPLY KLFGKWGTFV IFISIYVICF ILISQISLYS IISKFKLKKE KRRKEKNIEI KEDVQDEVKF TEIKDSEEIP EEKIINRIKI IDFIKNTNIE ENDDTKENKP IQKGKDSNNI QGEKDINKEL EEEMSKAALK TIDYEFPSID LLNDNKSIKL KKEDKKELLN NANKLEETLT SFGVEAKVTQ VTKGPSVTRF ELQPSVGVKV SKIVHLADDI ALNLAAQDVR IEAPIPGKSA VGIEVPNREL TPVYLKEVLD SNEFKNCNKN LAFAIGKDIA GNCVVSDLSK MPHLLIAGAT GSGKSVCINT LIISLIYKYS PEDVKLLMVD PKVVELNIYN DIPHLLIPVV TEPKKAAGAL YWAVNEMTRR YKLFAETNVR NIESYNELLK KGKGVEKLPL IVIVIDELAD LMMVCPNDIE DYIGRLAQMA RAAGMHLVIA TQRPSVDVIT GVIKANIPSR ISFAVSSQID SRTILDMGGA EKLLGKGDML FYPSGESKPM RVQGAFISEE EVEKVVGFIK EKQCGEVEYE DSIIDEINTS IEINNEDRDE LLEEAIKIVV DVDQASTSLL QRKLRIGYNR AARIMDQMEE RGIISQKDGS KPRQVLISKD DIV. It is sometimes possible for the material contained within the vial of "DNA translocase FtsK (ftsK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
