ATP-dependent zinc metalloprotease FtsH (ftsH) Recombinant Protein | Shel_02030 recombinant protein
Recombinant Slackia heliotrinireducens ATP-dependent zinc metalloprotease FtsH (ftsH)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent zinc metalloprotease FtsH (ftsH); Recombinant Slackia heliotrinireducens ATP-dependent zinc metalloprotease FtsH (ftsH); Recombinant ATP-dependent zinc metalloprotease FtsH (ftsH); ATP-dependent zinc metalloprotease FtsH EC= 3.4.24.-; Shel_02030 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
108-233
Sequence
NMVHGEETDDLTTSEFVQAVEQGRVENVVYNAGEYTVTGKYYPAATAGSTIAESYNSAIESVDVKLGTILEPSNPSSVGIETTSLEEKTLGTERNYTATYVGQDSLMELLSAHPEVEYQVTLPSNV
Sequence Length
783
Species
Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) (Peptococcus heliotrinreducens)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
85,802 Da
NCBI Official Full Name
membrane protease FtsH catalytic subunit
NCBI Official Symbol
Shel_02030
NCBI Protein Information
membrane protease FtsH catalytic subunit
UniProt Protein Name
ATP-dependent zinc metalloprotease FtsH
UniProt Gene Name
ftsH
UniProt Entry Name
FTSH_SLAHD
Uniprot Description
Function: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins
By similarity. HAMAP-Rule MF_01458
Cofactor: Binds 1 zinc ion per subunit
By similarity. HAMAP-Rule MF_01458
Subunit structure: Homohexamer
Potential.
Subcellular location: Cell membrane; Multi-pass membrane protein; Cytoplasmic side
By similarity HAMAP-Rule MF_01458.
Sequence similarities: In the central section; belongs to the AAA ATPase family.In the C-terminal section; belongs to the peptidase M41 family.
Similar Products
Product Notes
The Shel_02030 ftsh (Catalog #AAA1060811) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 108-233. The amino acid sequence is listed below: NMVHGEETDD LTTSEFVQAV EQGRVENVVY NAGEYTVTGK YYPAATAGST IAESYNSAIE SVDVKLGTIL EPSNPSSVGI ETTSLEEKTL GTERNYTATY VGQDSLMELL SAHPEVEYQV TLPSNV. It is sometimes possible for the material contained within the vial of "ATP-dependent zinc metalloprotease FtsH (ftsH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
