Ferric reductase transmembrane component 1 (frp1) Recombinant Protein | frp1 recombinant protein
Recombinant Schizosaccharomyces pombe Ferric reductase transmembrane component 1 (frp1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ferric reductase transmembrane component 1 (frp1); Recombinant Schizosaccharomyces pombe Ferric reductase transmembrane component 1 (frp1); frp1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-564aa; full length protein
Sequence
MAINSSDKWTVIAICLILGILLAFILMFWLERFRVIIKSNAHKHDPSDKRQIWLEKYYLF VRQIYTYLVTHKVILTLIAVPVVFAISIPFIGMQTPASSHGKQTTQVSTGNWSKNAVAAR LGFLACGLYVTSYFFSIKNNPFALLLISSHEKMNYVHRRLSQYAIMIGAIHGFAYIGLAA QGKRALLTARVTIIGYVILGLMVIMIVSSLPFFRRRFYEWFFVLHHMCSIGFLITIWLHH RRCVVYMKVCVAVYVFDRGCRMLRSFLNRSKFDVVLVEDDLIYMKGPRPKKSFFGLPWGA GNHMYINIPSLSYWQIHPFTIASVPSDDFIELFVAVRAGFTKRLAKKVSSKSLSDVSDIN ISDEKIEKNGDVGIEVMERHSLSQEDLVFESSAAKVSVLMDGPYGPVSNPYKDYSYLFLF AGGVGVSYILPIILDTIKKQSRTVHITFVWSARSSALLNIVHKSLCEAVRYTEMNINIFC HLTNSYPVEEVSSLNSQSARNYSLQYLNGRPDVNDYFKDFLHATGTQTAALASCGSDKLL RHLKSCVNTHSPSTVDLYQHYEEI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for frp1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,092 Da
NCBI Official Full Name
ferric-chelate reductase Frp1
NCBI Official Symbol
frp1
NCBI Protein Information
ferric-chelate reductase Frp1
UniProt Protein Name
Ferric reductase transmembrane component 1
Protein Family
UniProt Gene Name
frp1
UniProt Entry Name
FRP1_SCHPO
Uniprot Description
Metalloreductase responsible for reducing extracellular iron and copper prior to import (). Catalyzes the reductive uptake of Fe3+-salts and Fe3+ bound to catecholate or hydroxamate siderophores (). Fe3+ is reduced to Fe2+, which then dissociates from the siderophore and can be imported by the high-affinity Fe2+ transport complex in the plasma membrane (). Also participates in Cu2+ reduction and Cu+ uptake ().
Similar Products
Product Notes
The frp1 frp1 (Catalog #AAA7015181) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-564aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the frp1 frp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAINSSDKWT VIAICLILGI LLAFILMFWL ERFRVIIKSN AHKHDPSDKR QIWLEKYYLF VRQIYTYLVT HKVILTLIAV PVVFAISIPF IGMQTPASSH GKQTTQVSTG NWSKNAVAAR LGFLACGLYV TSYFFSIKNN PFALLLISSH EKMNYVHRRL SQYAIMIGAI HGFAYIGLAA QGKRALLTAR VTIIGYVILG LMVIMIVSSL PFFRRRFYEW FFVLHHMCSI GFLITIWLHH RRCVVYMKVC VAVYVFDRGC RMLRSFLNRS KFDVVLVEDD LIYMKGPRPK KSFFGLPWGA GNHMYINIPS LSYWQIHPFT IASVPSDDFI ELFVAVRAGF TKRLAKKVSS KSLSDVSDIN ISDEKIEKNG DVGIEVMERH SLSQEDLVFE SSAAKVSVLM DGPYGPVSNP YKDYSYLFLF AGGVGVSYIL PIILDTIKKQ SRTVHITFVW SARSSALLNI VHKSLCEAVR YTEMNINIFC HLTNSYPVEE VSSLNSQSAR NYSLQYLNGR PDVNDYFKDF LHATGTQTAA LASCGSDKLL RHLKSCVNTH SPSTVDLYQH YEEI. It is sometimes possible for the material contained within the vial of "Ferric reductase transmembrane component 1 (frp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
