Ferric/cupric reductase transmembrane component 2 (FRE2) Recombinant Protein | FRE2 recombinant protein
Recombinant Saccharomyces cerevisiae Ferric/cupric reductase transmembrane component 2 (FRE2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ferric/cupric reductase transmembrane component 2 (FRE2); Recombinant Saccharomyces cerevisiae Ferric/cupric reductase transmembrane component 2 (FRE2); Recombinant Ferric/cupric reductase transmembrane component 2 (FRE2); Ferric/cupric reductase transmembrane component 2 EC= 1.16.1.-; Ferric-chelate reductase 2; FRE2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-711
Sequence
KTVIRNKVPLLVTNACTRIFQKVTWEYTSKSKRSSPVCSYEPAFQSMLYCIYETLDEKGYSNKTLEKTFSTIKKNCASYSDALQNMTNSEFYDVLNNGTRHMTPYVKGSANLTYPVEMDTQLRKAYYHALHGFYANLDVGNIYGGIICAYFVAIMAFAGVLHCMNYTPFKTVLLKQKLVGYVRGYLTLPTIGSKHASDFSYFRIFTGYLPTRLEGIIILGYLVLHTVFLAYGYEYDPENIIFKSRRVQVARYVADRSGVLAFAHFPLIVLFAGRNNFLEYISGVKYTSFIMFHKWLGRMMFLDAMIHGSAYTSYTVANKTWATSKNRLYWQFGVAALCLAGTMVFFSFAVFRKYFYEAFLFLHIVLGAMFFYACWEHVVSLSGIEWIYTAIAIWIVDRIIRIIKASYFGFPKASLQLIGDDLIRLTVKKPARPWRAKPGQYVFVSFLHPLYFWQSHPFTVLDSVSKNGELVIILKEKKGVTRLVKKYVCRNGGKTSMRLAIEGPYGSSSPVNNYNNVLLLTGGTGLPGPIAHAIKLGKTSAAAGKQSVKLVIAVRGFDVLEAYKPELMCLENLNVQLHIYNTMEVPSLTPSDSLDISQQDEKADEKGTVVATTLEKSANPLGFDGVVFHCGRPNVKELLHEAAELSGSLSVVCCGPPIFVDKVRNETAKIVLDKSAKAIEYFEEYQCW
Sequence Length
711
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
80,072 Da
NCBI Official Full Name
Fre2p
NCBI Official Symbol
FRE2
NCBI Protein Information
Fre2p
UniProt Protein Name
Ferric/cupric reductase transmembrane component 2
UniProt Gene Name
FRE2
UniProt Entry Name
FRE2_YEAST
Uniprot Description
Function: Metalloreductase responsible for reducing extracellular iron and copper prior to import. Catalyzes the reductive uptake of Fe3+-salts and Fe3+ bound to catecholate or hydroxamate siderophores. Fe3+ is reduced to Fe2+, which then dissociates from the siderophore and can be imported by the high-affinity Fe2+ transport complex in the plasma membrane. Also participates in Cu2+ reduction and Cu+ uptake. Ref.6 Ref.11
Catalytic activity: 2 Fe2+ + NADP+ = 2 Fe3+ + NADPH.
Cofactor: FAD
Probable.Heme
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein Ref.4.
Induction: By transcription factors AFT1 and AFT2 upon iron deprivation. Ref.5 Ref.6 Ref.7 Ref.8 Ref.10 Ref.12
Sequence similarities: Belongs to the ferric reductase (FRE) family.Contains 1 FAD-binding FR-type domain.Contains 1 ferric oxidoreductase domain.
Similar Products
Product Notes
The FRE2 fre2 (Catalog #AAA1070415) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-711. The amino acid sequence is listed below: KTVIRNKVPL LVTNACTRIF QKVTWEYTSK SKRSSPVCSY EPAFQSMLYC IYETLDEKGY SNKTLEKTFS TIKKNCASYS DALQNMTNSE FYDVLNNGTR HMTPYVKGSA NLTYPVEMDT QLRKAYYHAL HGFYANLDVG NIYGGIICAY FVAIMAFAGV LHCMNYTPFK TVLLKQKLVG YVRGYLTLPT IGSKHASDFS YFRIFTGYLP TRLEGIIILG YLVLHTVFLA YGYEYDPENI IFKSRRVQVA RYVADRSGVL AFAHFPLIVL FAGRNNFLEY ISGVKYTSFI MFHKWLGRMM FLDAMIHGSA YTSYTVANKT WATSKNRLYW QFGVAALCLA GTMVFFSFAV FRKYFYEAFL FLHIVLGAMF FYACWEHVVS LSGIEWIYTA IAIWIVDRII RIIKASYFGF PKASLQLIGD DLIRLTVKKP ARPWRAKPGQ YVFVSFLHPL YFWQSHPFTV LDSVSKNGEL VIILKEKKGV TRLVKKYVCR NGGKTSMRLA IEGPYGSSSP VNNYNNVLLL TGGTGLPGPI AHAIKLGKTS AAAGKQSVKL VIAVRGFDVL EAYKPELMCL ENLNVQLHIY NTMEVPSLTP SDSLDISQQD EKADEKGTVV ATTLEKSANP LGFDGVVFHC GRPNVKELLH EAAELSGSLS VVCCGPPIFV DKVRNETAKI VLDKSAKAIE YFEEYQCW. It is sometimes possible for the material contained within the vial of "Ferric/cupric reductase transmembrane component 2 (FRE2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
