N-formyl peptide receptor 3 (FPR3) Recombinant Protein | FPR3 recombinant protein
Recombinant Pan troglodytes N-formyl peptide receptor 3 (FPR3)
Gene Names
FPR3; FPRL2; FMLP-R-II
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
N-formyl peptide receptor 3 (FPR3); Recombinant Pan troglodytes N-formyl peptide receptor 3 (FPR3); FPR3 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-349aa; full length protein
Sequence
METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVN TICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIA LDRCICVLHPAWAQNHRTMSLAKRVMTGLWILTIVLTLPNFIFWTTIRTTNGDTYCIFNF AFWGDTAVERLNVFITMAKVFLILHFIIGFSMPMSIITVCYGIIAAKIHRNHMIKSSRPL RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTHTTSASPPEETE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Pan troglodytes (Chimpanzee)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FPR3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39,611 Da
NCBI Official Full Name
N-formyl peptide receptor 3
NCBI Official Symbol
FPR3
NCBI Official Synonym Symbols
FPRL2; FMLP-R-II
NCBI Protein Information
N-formyl peptide receptor 3
UniProt Protein Name
N-formyl peptide receptor 3
Protein Family
UniProt Gene Name
FPR3
UniProt Synonym Gene Names
FPRL2; FMLP-R-II
UniProt Entry Name
FPR3_PANTR
Uniprot Description
Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Similar Products
Product Notes
The FPR3 fpr3 (Catalog #AAA7014997) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-349aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FPR3 fpr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: METNFSIPLN ETEEVLPEPA GHTVLWIFSL LVHGVTFVFG VLGNGLVIWV AGFRMTRTVN TICYLNLALA DFSFSAILPF RMVSVAMREK WPFGSFLCKL VHVMIDINLF VSVYLITIIA LDRCICVLHP AWAQNHRTMS LAKRVMTGLW ILTIVLTLPN FIFWTTIRTT NGDTYCIFNF AFWGDTAVER LNVFITMAKV FLILHFIIGF SMPMSIITVC YGIIAAKIHR NHMIKSSRPL RVFAAVVASF FICWFPYELI GILMAVWLKE MLLNGKYKII LVLINPTSSL AFFNSCLNPI LYVFMGRNFQ ERLIRSLPTS LERALTEVPD SAQTSNTHTT SASPPEETE. It is sometimes possible for the material contained within the vial of "N-formyl peptide receptor 3 (FPR3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
