Forkhead box protein P1 Recombinant Protein | FOXP1 recombinant protein

Recombinant Human Forkhead box protein P1

Cat. Num. AAA1265243

• Gene Names: FOXP1; MFH; QRF1; 12CC4; hFKH1B; HSPC215
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Forkhead box protein P1; Recombinant Human Forkhead box protein P1; Mac-1-regulated forkhead1; FOXP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-114aa; Partial
• Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQ
• Sequence Length: 114

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for FOXP1 recombinant protein

Transcriptional repressor. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal chord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in embryonic st cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintainance of hair follicle st cell quiescence; the function probably involves regulation of FGF18. Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis. Binds to CSF1R promoter elements and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes ses to involve NCOR2 as corepressor. Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization ses to implicate suppression of SA5B. Can negatively regulate androgen receptor signaling.

Product Categories/Family for FOXP1 recombinant protein

Transcription

References

The FOXP1 winged helix transcription factor is a novel candidate tumor suppressor gene on chromosome 3p.Banham A.H., Beasley N., Campo E., Fernandez P.L., Fidler C., Gatter K., Jones M., Mason D.Y., Prime J.E., Trougouboff P., Wood K., Cordell J.L.Cancer Res. 61:8820-8829(2001)

NCBI and Uniprot Product Information

• NCBI GI #: 60498987
• NCBI GeneID: 27086
• NCBI Accession #: NP_001012523.1
• NCBI GenBank Nucleotide #: NM_001012505.1
• UniProt Accession #: Q9H334; Q8NAN6; Q9BSG9; Q9H332; Q9H333; Q9P0R1; A3QVP8; B3KV70; G5E9V8
• Molecular Weight: 39.2 kDa
• NCBI Official Full Name: forkhead box protein P1 isoform 2
• NCBI Official Synonym Full Names: forkhead box P1
• NCBI Official Symbol: FOXP1
• NCBI Official Synonym Symbols: MFH; QRF1; 12CC4; hFKH1B; HSPC215
• NCBI Protein Information: forkhead box protein P1
• UniProt Protein Name: Forkhead box protein P1
• Protein Family: Forkhead box protein
• UniProt Gene Name: FOXP1
• UniProt Synonym Gene Names: MFH
• UniProt Entry Name: FOXP1_HUMAN

NCBI Description

This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXP1: Transcriptional repressor. It plays an important role in the specification and differentiation of lung epithelium. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Essential transcriptional regulator of B-cell development. Forms homodimers and heterodimers with FOXP2 and FOXP4. Dimerization is required for DNA-binding. Interacts with CTBP1. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; DNA-binding; Cell cycle regulation; Transcription factor

Chromosomal Location of Human Ortholog: 3p14.1

Cellular Component: nucleoplasm; nucleus

Molecular Function: androgen receptor binding; metal ion binding; protein binding; protein self-association; sequence-specific DNA binding

Biological Process: anatomical structure morphogenesis; endothelial cell activation; macrophage activation; monocyte activation; negative regulation of B cell apoptosis; negative regulation of transcription, DNA-dependent; osteoclast differentiation; positive regulation of smooth muscle cell proliferation; regulation of inflammatory response; regulation of interleukin-1 beta secretion; regulation of monocyte differentiation; regulation of transcription from RNA polymerase II promoter; regulation of tumor necrosis factor production; response to lipopolysaccharide; transcription, DNA-dependent

Disease: Mental Retardation With Language Impairment And With Or Without Autistic Features