Fos-related antigen 2 (Fosl2) Recombinant Protein | Fosl2 recombinant protein
Recombinant Rat Fos-related antigen 2 (Fosl2)
Gene Names
Fosl2; Fra2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fos-related antigen 2 (Fosl2); Recombinant Rat Fos-related antigen 2 (Fosl2); Fosl2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-326, Full length protein
Sequence
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPTSGLQSLRGTGSAVGPVVVKQEPPEEDSPSSSAGMDKTQRSVIKPISIAGGGFYGEEPLHTPIVVTSTPAITPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL
Sequence Length
326
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Fosl2 recombinant protein
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,255 Da
NCBI Official Full Name
fos-related antigen 2 isoform 1
NCBI Official Synonym Full Names
FOS like 2, AP-1 transcription factor subunit
NCBI Official Symbol
Fosl2
NCBI Official Synonym Symbols
Fra2
NCBI Protein Information
fos-related antigen 2
UniProt Protein Name
Fos-related antigen 2
Protein Family
UniProt Gene Name
Fosl2
UniProt Synonym Gene Names
Fra-2; Fra2; FRA-2
NCBI Description
member of the Fos family of transcription factors with circadian regulation [RGD, Feb 2006]
Uniprot Description
Controls osteoclast survival and size (). As a dimer with JUN, activates LIF transcription (). Activates CEBPB transcription in PGE2-activated osteoblasts.
Research Articles on Fosl2
Similar Products
Product Notes
The Fosl2 fosl2 (Catalog #AAA958706) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-326, Full length protein. The amino acid sequence is listed below: MYQDYPGNFD TSSRGSSGSP AHAESYSSGG GGQQKFRVDM PGSGSAFIPT INAITTSQDL QWMVQPTVIT SMSNPYPRSH PYSPLPGLAS VPGHMALPRP GVIKTIGTTV GRRRRDEQLS PEEEEKRRIR RERNKLAAAK CRNRRRELTE KLQAETEELE EEKSGLQKEI AELQKEKEKL EFMLVAHGPV CKISPEERRS PPTSGLQSLR GTGSAVGPVV VKQEPPEEDS PSSSAGMDKT QRSVIKPISI AGGGFYGEEP LHTPIVVTST PAITPGTSNL VFTYPSVLEQ ESPASPSESC SKAHRRSSSS GDQSSDSLNS PTLLAL. It is sometimes possible for the material contained within the vial of "Fos-related antigen 2 (Fosl2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
