Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human VEGFR3/FLT4 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing bands at 150-160 kDa, 90-95 kDa and 60-70 kDa.)

VEGFR3/FLT4 Recombinant Protein | VEGFR3 recombinant protein

Recombinant Human VEGFR3/FLT4 Protein

Gene Names
FLT4; PCL; FLT-4; FLT41; LMPH1A; LMPHM1; VEGFR3; VEGFR-3
Purity
> 90% by SDS-PAGE.
Synonyms
VEGFR3/FLT4; Recombinant Human VEGFR3/FLT4 Protein; Flt4; FLT-4; FLT41; LMPH1A; PCL; VEGFR-3; VEGFR3; VEGFR3 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 cells
Purity/Purification
> 90% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 muM filtered solution of PBS, pH 7.4.
Sequence
YSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWV
Sequence Length
1298
Species
Human
Endotoxin
< 0.1 EU/mug of the protein by LAL method.
Tag
Fc, 6xHis tag at the C-terminus
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Protein Construction
High quality, high purity and low endotoxin recombinant Recombinant Human VEGFR3/FLT4 Protein (RP00123), tested reactivity in Human and has been validated in SDS-PAGE.100% guaranteed.
Preparation and Storage
Store the lyophilized protein at-20 degree C to-80 degree C for long term.
After reconstitution, the protein solution is stable at-20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human VEGFR3/FLT4 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing bands at 150-160 kDa, 90-95 kDa and 60-70 kDa.)

SDS-Page (Recombinant Human VEGFR3/FLT4 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing bands at 150-160 kDa, 90-95 kDa and 60-70 kDa.)
Related Product Information for VEGFR3 recombinant protein
Description: Recombinant Human VEGFR3/FLT4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Tyr25-Ile776) of human VEGFR3/FLT4 (Accession #NP_891555.2) fused with an Fc, 6xHis tag at the C-terminus.
Background: The protein is a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
145,599 Da
NCBI Official Full Name
vascular endothelial growth factor receptor 3 isoform 2
NCBI Official Synonym Full Names
fms related tyrosine kinase 4
NCBI Official Symbol
FLT4
NCBI Official Synonym Symbols
PCL; FLT-4; FLT41; LMPH1A; LMPHM1; VEGFR3; VEGFR-3
NCBI Protein Information
vascular endothelial growth factor receptor 3
UniProt Protein Name
Vascular endothelial growth factor receptor 3
UniProt Gene Name
FLT4
UniProt Synonym Gene Names
VEGFR3; VEGFR-3; FLT-4

NCBI Description

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq, Jul 2008]

Uniprot Description

Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFC and VEGFD, and plays an essential role in adult lymphangiogenesis and in the development of the vascular network and the cardiovascular system during embryonic development. Promotes proliferation, survival and migration of endothelial cells, and regulates angiogenic sprouting. Signaling by activated FLT4 leads to enhanced production of VEGFC, and to a lesser degree VEGFA, thereby creating a positive feedback loop that enhances FLT4 signaling. Modulates KDR signaling by forming heterodimers. The secreted isoform 3 may function as a decoy receptor for VEGFC and/or VEGFD and play an important role as a negative regulator of VEGFC-mediated lymphangiogenesis and angiogenesis. Binding of vascular growth factors to isoform 1 or isoform 2 leads to the activation of several signaling cascades; isoform 2 seems to be less efficient in signal transduction, because it has a truncated C-terminus and therefore lacks several phosphorylation sites. Mediates activation of the MAPK1/ERK2, MAPK3/ERK1 signaling pathway, of MAPK8 and the JUN signaling pathway, and of the AKT1 signaling pathway. Phosphorylates SHC1. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Promotes phosphorylation of MAPK8 at 'Thr-183' and 'Tyr-185', and of AKT1 at 'Ser-473'.

Research Articles on VEGFR3

Similar Products

Product Notes

The VEGFR3 flt4 (Catalog #AAA9139720) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: YSMTPPTLNI TEESHVIDTG DSLSISCRGQ HPLEWAWPGA QEAPATGDKD SEDTGVVRDC EGTDARPYCK VLLLHEVHAN DTGSYVCYYK YIKARIEGTT AASSYVFVRD FEQPFINKPD TLLVNRKDAM WVPCLVSIPG LNVTLRSQSS VLWPDGQEVV WDDRRGMLVS TPLLHDALYL QCETTWGDQD FLSNPFLVHI TGNELYDIQL LPRKSLELLV GEKLVLNCTV WAEFNSGVTF DWDYPGKQAE RGKWV. It is sometimes possible for the material contained within the vial of "VEGFR3/FLT4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.