SDS-Page
Fms-related tyrosine kinase 3 ligand (FLT3LG) Recombinant Protein | FLT3LG recombinant protein
Recombinant Human Fms-related tyrosine kinase 3 ligand (FLT3LG), partial
Gene Names
FLT3LG; FL; FLG3L; FLT3L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fms-related tyrosine kinase 3 ligand (FLT3LG); Recombinant Human Fms-related tyrosine kinase 3 ligand (FLT3LG); partial; SL cytokine; FLT3LG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-184. Partial, provide the complete extracellular domain.
Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
Organism
Homo sapiens (Human)
Tag Information
N-terminal 6xHis-SUMO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-Page
SDS-Page
Related Product Information for FLT3LG recombinant protein
Stimulates the proliferation of early hatopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Product Categories/Family for FLT3LG recombinant protein
References
Flt3 ligand structure and unexpected commonalities of helical bundles and cystine knots.Savvides S.N., Boone T., Karplus P.A.Nat. Struct. Biol. 7:486-491 (2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33.9 kDa
NCBI Official Full Name
fms-related tyrosine kinase 3 ligand isoform 1
NCBI Official Synonym Full Names
fms related tyrosine kinase 3 ligand
NCBI Official Symbol
FLT3LG
NCBI Official Synonym Symbols
FL; FLG3L; FLT3L
NCBI Protein Information
fms-related tyrosine kinase 3 ligand
UniProt Protein Name
Fms-related tyrosine kinase 3 ligand
Protein Family
UniProt Gene Name
FLT3LG
UniProt Synonym Gene Names
Flt3 ligand; Flt3L
NCBI Description
Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011]
Uniprot Description
Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Research Articles on FLT3LG
Similar Products
Product Notes
The FLT3LG flt3lg (Catalog #AAA7110854) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-184. Partial, provide the complete extracellular domain. with tag N-terminal 6xHis-SUMO-tagged. The amino acid sequence is listed below: TQDCSFQHSP ISSDFAVKIR ELSDYLLQDY PVTVASNLQD EELCGGLWRL VLAQRWMERL KTVAGSKMQG LLERVNTEIH FVTKCAFQPP PSCLRFVQTN ISRLLQETSE QLVALKPWIT RQNFSRCLEL QCQPDSSTLP PPWSPRPLEA TAPTAPQP . It is sometimes possible for the material contained within the vial of "Fms-related tyrosine kinase 3 ligand (FLT3LG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
