Calcium channel flower (flower) Recombinant Protein | DsecGM24464 recombinant protein
Recombinant Drosophila sechellia Calcium channel flower (flower)
Gene Names
DsecGM24464; dsec_GLEANR_7465; GM24464
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium channel flower (flower); Recombinant Drosophila sechellia Calcium channel flower (flower); Recombinant Calcium channel flower (flower); Calcium channel flower; DsecGM24464 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-194
Sequence
MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVSCLVAGIIQMVAGFVVMLLEALCCFVCFEQVNVIADKVDSKPLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGMMALGKKASAEDMRAAAQQTFGGNTPAQTNDRAGIVNNAQPFSFTGAVGTDSNV
Sequence Length
194
Species
Drosophila sechellia (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,650 Da
NCBI Official Full Name
GM24464
NCBI Official Symbol
DsecGM24464
NCBI Official Synonym Symbols
dsec_GLEANR_7465; GM24464
NCBI Protein Information
GM24464 gene product from transcript GM24464-RA; DsecGM24464-PA
UniProt Protein Name
Calcium channel flower
UniProt Gene Name
flower
UniProt Entry Name
FLOWR_DROSE
Uniprot Description
Function: A calcium channel that regulates synaptic endocytosis and hence couples exo- with endocytosis. Required in the nervous system and necessary in photoreceptor cells
By similarity. UniProtKB Q95T12
Subunit structure: Homomultimer
By similarity. UniProtKB Q95T12
Subcellular location: Cytoplasmic vesicle › secretory vesicle › synaptic vesicle membrane; Multi-pass membrane protein
By similarity. Note: Upon fusion of the synaptic vesicle with the presynaptic membrane, protein is present in the periactive zones, where endocytosis is known to occur
By similarity. UniProtKB Q95T12
Sequence similarities: Belongs to the calcium channel flower family.
Similar Products
Product Notes
The DsecGM24464 flower (Catalog #AAA1206194) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-194. The amino acid sequence is listed below: MSFAEKITGL LARPNQQDPI GPEQPWYLKY GSRLLGIVAA FFAILFGLWN VFSIITLSVS CLVAGIIQMV AGFVVMLLEA LCCFVCFEQV NVIADKVDSK PLYFRAGLYI AMAIPPIILC FGLASLFGSG LIFGTGVVYG MMALGKKASA EDMRAAAQQT FGGNTPAQTN DRAGIVNNAQ PFSFTGAVGT DSNV. It is sometimes possible for the material contained within the vial of "Calcium channel flower (flower), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
