Flightless-1 homolog Recombinant Protein | Flii recombinant protein

Recombinant Mouse Protein flightless-1 homolog

Cat. Num. AAA1380498

• Gene Names: Flii; Fliih; 3632430F08Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Flightless-1 homolog; Recombinant Mouse Protein flightless-1 homolog; Flii recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 495-827. Partial, provide the Interaction with ACTL6A Region
• Sequence: VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGSSLDPRFVFLLDQGLDIYVWRGAQATLSNTTKARLFAEKINKNERKGKAEITLLVQGQEPPGFWDVLGGEPSEIKNHVPDDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKKRPKVELMPGMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHTVVSRSLEGTE
• Sequence Length: 827

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Flii recombinant protein

May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling. Essential for early embryonic development. May play a role in regulation of cytoskeletal rearrangents involved in cytokinesis and cell migration, by inhibiting Rac1-dependent paxillin phosphorylation.

References

Fliih, the murine homologue of the Drosophila melanogaster flightless I gene nucleotide sequence, chromosomal mapping and overlap with Llglh.Campbell H.D., Fountain S., Young I.G., Weitz S., Lichter P., Hoheisel J.D.DNA Seq. 11:29-40(2000) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) The flightless I protein localizes to actin-based structures during embryonic development.Davy D.A., Ball E.E., Matthaei K.I., Campbell H.D., Crouch M.F.Immunol. Cell Biol. 78:423-429(2000) Fliih, a gelsolin-related cytoskeletal regulator essential for early mammalian embryonic development.Campbell H.D., Fountain S., McLennan I.S., Berven L.A., Crouch M.F., Davy D.A., Hooper J.A., Waterford K., Chen K.-S., Lupski J.R., Ledermann B., Young I.G., Matthaei K.I.Mol. Cell. Biol. 22:3518-3526(2002) Developmentally essential protein flightless I is a nuclear receptor coactivator with actin binding activity.Lee Y.-H., Campbell H.D., Stallcup M.R.Mol. Cell. Biol. 24:2103-2117(2004) The flightless I protein colocalizes with actin- and microtubule-based structures in motile Swiss 3T3 fibroblasts evidence for the involvement of PI 3-kinase and Ras-related small GTPases.Davy D.A., Campbell H.D., Fountain S., de Jong D., Crouch M.F.J. Cell Sci. 114:549-562(2001) Regulation of focal adhesions by flightless i involves inhibition of paxillin phosphorylation via a Rac1-dependent pathway.Kopecki Z., O'Neill G.M., Arkell R.M., Cowin A.J.J. Invest. Dermatol. 131:1450-1459(2011) Flightless I is a focal adhesion-associated actin-capping protein that regulates cell migration.Mohammad I., Arora P.D., Naghibzadeh Y., Wang Y., Li J., Mascarenhas W., Janmey P.A., Dawson J.F., McCulloch C.A.FASEB J. 26:3260-3272(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 11528490
• NCBI GeneID: 14248
• NCBI Accession #: NP_071292.1
• NCBI GenBank Nucleotide #: NM_022009.2
• UniProt Accession #: Q9JJ28; Q8K095; Q8VI44
• Molecular Weight: 40 kDa
• NCBI Official Full Name: protein flightless-1 homolog isoform 1
• NCBI Official Synonym Full Names: flightless I actin binding protein
• NCBI Official Symbol: Flii
• NCBI Official Synonym Symbols: Fliih; 3632430F08Rik
• NCBI Protein Information: protein flightless-1 homolog
• UniProt Protein Name: Protein flightless-1 homolog
• Protein Family: Flagellum-specific ATP synthase
• UniProt Gene Name: Flii
• UniProt Synonym Gene Names: Fli1; Fliih
• UniProt Entry Name: FLII_MOUSE

NCBI Description

This gene encodes a protein with gelsolin-like repeats and an N-terminal leucine-rich repeat domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This protein may act as an actin-remodelling protein as well as a transcriptional coactivator. Homozygous knockout mice show embryonic lethality. This protein may act to regulate wound repair. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]

Uniprot Description

FLI: May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling. Involved in early embryonic development. May play a role in regulation of cytoskeletal rearrangements involved in cytokinesis and cell migration. Deletion of the FLII gene may be a cause of Smith-Magenis syndrome (SMS). It is a contiguous gene deletion syndrome involving developmental abnormalities and mental retardation. The spectrum of clinical findings includes short stature, brachydactyly, developmental delay, dysmorphic features, sleep disturbances, and behavioral problems.

Protein type: Actin-binding; Nuclear receptor co-regulator

Cellular Component: brush border; cell junction; cytoplasm; cytoskeleton; microtubule organizing center; nucleoplasm; nucleus

Molecular Function: actin binding; protein binding

Biological Process: actin cytoskeleton organization and biogenesis; actin filament severing; multicellular organismal development; regulation of transcription, DNA-dependent; transcription, DNA-dependent