Flagellar biosynthesis protein flhA (flhA) Recombinant Protein | flhA recombinant protein
Recombinant Brucella melitensis biotype 1 Flagellar biosynthesis protein flhA (flhA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Flagellar biosynthesis protein flhA (flhA); Recombinant Brucella melitensis biotype 1 Flagellar biosynthesis protein flhA (flhA); flhA recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-723aa; full length protein
Sequence
MKQTLGAVPAARLTGTGPMSVAKQEADVQQAAAKPFIKGKFLTGSDIGLAVGIIIILTVL FLPVPAVVLDIGLAFSIAFSVLILMVALWIQRPLDFSAFPTVLLIATMMRLSLNIATTRV ILTHGNEGYLAAGHVIHGFSQFVMGGDFVIGLVVFAILIIVNFLVITKGATRIAEVGARF TLDAIPGKQMAIDADLSSGLIDEKEAQRRRRELEEESSFFGSMDGASKFVRGDAIAGLII TAVNIFGGIVIGATRHGMDISQAADVFTKLSVGDGLVTQIPALIVSLAAGLLVSKGGTRG SADQAIFGQLGAYPKALLIAALLLFILGVMPGLPAFPFFLLGGAMAFVGIAVPRRQARQR EADAAEAGKKQREAEEQERNSVKASLETNQIELCLGKQLSARLIASQEELAHRVNKMRRK FAQEYGFVIPEIKVTDDIALPPKSYRIKIHGTAVASHELRVGEILVVLGERPVPSVPGEE VREPAFGMRAYSVPETFTADLRREGYMTVDNLSVLLTHLSEIVRNNLAQLLSYKDMRILL DRLGPEYRKLLEDICPAHISYSGLQAVLKLLLAERISIRNLHLILEAIAEIAPLVRRPEM IVEHVRMRMAQQICGDLSDNGVLNVLRLGNRWDLVFHQSLKRDAKGEIVEFDIDPRLLEQ FGTEASAAIRKHFDNGERFVLVSSPEARPYIRMIIERLFATLPVLSHVEIARGVEVKSLG AIS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for flhA recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
78,724 Da
NCBI Official Full Name
Flagellar biosynthesis protein FlhA
UniProt Protein Name
Flagellar biosynthesis protein FlhA
Protein Family
UniProt Gene Name
flhA
UniProt Entry Name
FLHA_BRUME
Uniprot Description
Required for formation of the rod structure of the flagellar apparatus. May constitute the export apparatus of flagellin (). The flagellum is required to cause a persistent disease in a murine model of infection.
Similar Products
Product Notes
The flhA flha (Catalog #AAA7014843) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-723aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the flhA flha for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKQTLGAVPA ARLTGTGPMS VAKQEADVQQ AAAKPFIKGK FLTGSDIGLA VGIIIILTVL FLPVPAVVLD IGLAFSIAFS VLILMVALWI QRPLDFSAFP TVLLIATMMR LSLNIATTRV ILTHGNEGYL AAGHVIHGFS QFVMGGDFVI GLVVFAILII VNFLVITKGA TRIAEVGARF TLDAIPGKQM AIDADLSSGL IDEKEAQRRR RELEEESSFF GSMDGASKFV RGDAIAGLII TAVNIFGGIV IGATRHGMDI SQAADVFTKL SVGDGLVTQI PALIVSLAAG LLVSKGGTRG SADQAIFGQL GAYPKALLIA ALLLFILGVM PGLPAFPFFL LGGAMAFVGI AVPRRQARQR EADAAEAGKK QREAEEQERN SVKASLETNQ IELCLGKQLS ARLIASQEEL AHRVNKMRRK FAQEYGFVIP EIKVTDDIAL PPKSYRIKIH GTAVASHELR VGEILVVLGE RPVPSVPGEE VREPAFGMRA YSVPETFTAD LRREGYMTVD NLSVLLTHLS EIVRNNLAQL LSYKDMRILL DRLGPEYRKL LEDICPAHIS YSGLQAVLKL LLAERISIRN LHLILEAIAE IAPLVRRPEM IVEHVRMRMA QQICGDLSDN GVLNVLRLGN RWDLVFHQSL KRDAKGEIVE FDIDPRLLEQ FGTEASAAIR KHFDNGERFV LVSSPEARPY IRMIIERLFA TLPVLSHVEI ARGVEVKSLG AIS. It is sometimes possible for the material contained within the vial of "Flagellar biosynthesis protein flhA (flhA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
