Fat storage-inducing transmembrane protein 2 (Fitm2) Recombinant Protein | Fitm2 recombinant protein
Recombinant Mouse Fat storage-inducing transmembrane protein 2 (Fitm2)
Gene Names
Fitm2; Fit2; AI414861; D930001I22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fat storage-inducing transmembrane protein 2 (Fitm2); Recombinant Mouse Fat storage-inducing transmembrane protein 2 (Fitm2); Fitm2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-262. Full Length
Sequence
MEHLERCAWFLRGTLVRATVRRHLPWALVAAMLAGSVVKELSPLPESYLSNKRNVLNVYFVKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLVGTAIWYICTALFSNIEHYTGSCYQSPALEGIRQEHRSKQQCHREGGFWHGFDISGHSFLLTFCALMIVEEMAVLHEVKTDRGHHLHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLTQKVFGTMFGLLGWYGTYGYWYLKSFSPGLPPQSCSLTLKRDTYKK
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Fitm2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,016 Da
NCBI Official Full Name
fat storage-inducing transmembrane protein 2
NCBI Official Synonym Full Names
fat storage-inducing transmembrane protein 2
NCBI Official Symbol
Fitm2
NCBI Official Synonym Symbols
Fit2; AI414861; D930001I22Rik
NCBI Protein Information
fat storage-inducing transmembrane protein 2
UniProt Protein Name
Fat storage-inducing transmembrane protein 2
Protein Family
UniProt Gene Name
Fitm2
UniProt Synonym Gene Names
Fit2
UniProt Entry Name
FITM2_MOUSE
Uniprot Description
FITM2: Plays an important role in lipid droplet accumulation. Plays a role in the regulation of cell morphology and cytoskeletal organization. Belongs to the FIT family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: cell; endoplasmic reticulum; endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; integral to membrane; membrane; mitochondrion
Biological Process: cytoskeleton organization and biogenesis; phospholipid biosynthetic process; regulation of cell morphogenesis; sequestering of lipid; sequestering of triacylglycerol
Research Articles on Fitm2
Similar Products
Product Notes
The Fitm2 fitm2 (Catalog #AAA7014819) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-262. Full Length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Fitm2 fitm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEHLERCAWF LRGTLVRATV RRHLPWALVA AMLAGSVVKE LSPLPESYLS NKRNVLNVYF VKLAWAWTVC LLLPFIALTN YHLTGKTSLV LRRLSTLLVG TAIWYICTAL FSNIEHYTGS CYQSPALEGI RQEHRSKQQC HREGGFWHGF DISGHSFLLT FCALMIVEEM AVLHEVKTDR GHHLHAAITT LVVALGFLTF IWVWMFLCTA VYFHDLTQKV FGTMFGLLGW YGTYGYWYLK SFSPGLPPQS CSLTLKRDTY KK . It is sometimes possible for the material contained within the vial of "Fat storage-inducing transmembrane protein 2 (Fitm2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
