Cation-efflux pump FieF (fieF) Recombinant Protein | fieF recombinant protein
Recombinant Salmonella paratyphi A Cation-efflux pump FieF (fieF)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cation-efflux pump FieF (fieF); Recombinant Salmonella paratyphi A Cation-efflux pump FieF (fieF); Recombinant Cation-efflux pump FieF (fieF); Cation-efflux pump FieF; fieF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-300
Sequence
MNQTYGRLVSRAAIAATAMASALLLIKILAWWYTGSVSILAALVDSLVDIAASLTNLLVVRYSLQPADDEHTFGHGKAESLAALAQSMFISGSALFLFLTSIQNLIKPTPMNDPGVGIGVTVIALICTIILVTFQRWVVRKTQSQAVRADMLHYQSDVMMNGAILIALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDAERQEIIDIVTSWPGVSGAHDLRTRQSGPTRFIQIHLEMEDNLPLVQAHFVADQVEQAILRRFPGSDVIIHQDPCSVVPREGRKFELV
Sequence Length
300
Species
Salmonella paratyphi A (strain AKU_12601)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,968 Da
NCBI Official Full Name
ferrous iron efflux protein F
NCBI Official Symbol
fieF
NCBI Protein Information
ferrous iron efflux protein F
UniProt Protein Name
Cation-efflux pump FieF
Protein Family
UniProt Gene Name
fieF
UniProt Entry Name
FIEF_SALPK
Uniprot Description
Function: Cation-efflux transporter that may have a role in detoxification
By similarity. HAMAP-Rule MF_01425
Subunit structure: Homodimer
By similarity. HAMAP-Rule MF_01425
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01425.
Sequence similarities: Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. FieF subfamily. [View classification]
Similar Products
Product Notes
The fieF fief (Catalog #AAA1234119) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-300. The amino acid sequence is listed below: MNQTYGRLVS RAAIAATAMA SALLLIKILA WWYTGSVSIL AALVDSLVDI AASLTNLLVV RYSLQPADDE HTFGHGKAES LAALAQSMFI SGSALFLFLT SIQNLIKPTP MNDPGVGIGV TVIALICTII LVTFQRWVVR KTQSQAVRAD MLHYQSDVMM NGAILIALGL SWYGWHRADA LFALGIGIYI LYSALRMGYE AVQSLLDRAL PDAERQEIID IVTSWPGVSG AHDLRTRQSG PTRFIQIHLE MEDNLPLVQA HFVADQVEQA ILRRFPGSDV IIHQDPCSVV PREGRKFELV. It is sometimes possible for the material contained within the vial of "Cation-efflux pump FieF (fieF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
