SDS-PAGE
Fin bud initiation factor homolog (FIBIN) Recombinant Protein | FIBIN recombinant protein
Recombinant Human Fin bud initiation factor homolog (FIBIN)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fin bud initiation factor homolog (FIBIN); Recombinant Human Fin bud initiation factor homolog (FIBIN); FIBIN recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-211aa; Full Length of Mature Protein
Sequence
YFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Product Categories/Family for FIBIN recombinant protein
References
Fibin, a novel secreted lateral plate mesoderm signal, is essential for pectoral fin bud initiation in zebrafish.Wakahara T., Kusu N., Yamauchi H., Kimura I., Konishi M., Miyake A., Itoh N.Dev. Biol. 303:527-535(2007)
Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y., Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.DNA Res. 12:117-126(2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.1 kDa
NCBI Official Full Name
fin bud initiation factor homolog
NCBI Official Synonym Full Names
fin bud initiation factor homolog (zebrafish)
NCBI Official Symbol
FIBIN
NCBI Protein Information
fin bud initiation factor homolog
UniProt Protein Name
Fin bud initiation factor homolog
Protein Family
UniProt Gene Name
FIBIN
UniProt Entry Name
FIBIN_HUMAN
Uniprot Description
FIBIN: Belongs to the FIBIN family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 11p14.2
Cellular Component: endoplasmic reticulum; extracellular region; Golgi apparatus
Research Articles on FIBIN
Similar Products
Product Notes
The FIBIN fibin (Catalog #AAA1468473) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-211aa; Full Length of Mature Protein. The amino acid sequence is listed below: YFDGPLYPEM SNGTLHHYFV PDGDYEENDD PEKCQLLFRV SDHRRCSQGE GSQVGSLLSL TLREEFTVLG RQVEDAGRVL EGISKSISYD LDGEESYGKY LRRESHQIGD AYSNSDKSLT ELESKFKQGQ EQDSRQESRL NEDFLGMLVH TRSLLKETLD ISVGLRDKYE LLALTIRSHG TRLGRLKNDY LKV . It is sometimes possible for the material contained within the vial of "Fin bud initiation factor homolog (FIBIN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
