Ferrichrome-iron receptor (fhuA) Recombinant Protein | fhuA recombinant protein
Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial
Gene Names
fhuA; ECK0149; JW0146; T1; tonA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ferrichrome-iron receptor (fhuA); Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA); partial; fhuA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
34-747
Sequence
AVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF
Sequence Length
747
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
82,182 Da
NCBI Official Full Name
ferrichrome outer membrane transporter
NCBI Official Symbol
fhuA
NCBI Official Synonym Symbols
ECK0149; JW0146; T1; tonA
NCBI Protein Information
ferrichrome outer membrane transporter
UniProt Protein Name
Ferrichrome outer membrane transporter/phage receptor
Protein Family
UniProt Gene Name
fhuA
NCBI Description
fhuA mutants are albomycin resistant. [More information is available at EcoGene: EG10302]. FhuA is involved with the transport of ferrichrome across the outer membrane . [More information is available at EcoCyc: EG10302].
Uniprot Description
Involved in the uptake of iron in complex with ferrichrome, an hydroxamate-type siderophore. Binds and transports ferrichrome-iron across the outer membrane (PubMed:1089064, PubMed:2066336). In addition to its role in ferrichrome-iron transport, transports the antibiotic albomycin, which is a structural analog of ferrichrome, and acts as a receptor for colicin M, microcin J25 and bacteriophages T1, T5, phi80 and UC-1 (PubMed:1089064, PubMed:353030, PubMed:2066336, PubMed:8617231). The energy source, which is required for all FhuA functions except infection by phage T5, is provided by the inner membrane TonB system (PubMed:353030, PubMed:9353297, PubMed:12427941).
Research Articles on fhuA
Similar Products
Product Notes
The fhuA fhua (Catalog #AAA1106386) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-747. The amino acid sequence is listed below: AVEPKEDTIT VTAAPAPQES AWGPAATIAA RQSATGTKTD TPIQKVPQSI SVVTAEEMAL HQPKSVKEAL SYTPGVSVGT RGASNTYDHL IIRGFAAEGQ SQNNYLNGLK LQGNFYNDAV IDPYMLERAE IMRGPVSVLY GKSSPGGLLN MVSKRPTTEP LKEVQFKAGT DSLFQTGFDF SDSLDDDGVY SYRLTGLARS ANAQQKGSEE QRYAIAPAFT WRPDDKTNFT FLSYFQNEPE TGYYGWLPKE GTVEPLPNGK RLPTDFNEGA KNNTYSRNEK MVGYSFDHEF NDTFTVRQNL RFAENKTSQN SVYGYGVCSD PANAYSKQCA ALAPADKGHY LARKYVVDDE KLQNFSVDTQ LQSKFATGDI DHTLLTGVDF MRMRNDINAW FGYDDSVPLL NLYNPVNTDF DFNAKDPANS GPYRILNKQK QTGVYVQDQA QWDKVLVTLG GRYDWADQES LNRVAGTTDK RDDKQFTWRG GVNYLFDNGV TPYFSYSESF EPSSQVGKDG NIFAPSKGKQ YEVGVKYVPE DRPIVVTGAV YNLTKTNNLM ADPEGSFFSV EGGEIRARGV EIEAKAALSA SVNVVGSYTY TDAEYTTDTT YKGNTPAQVP KHMASLWADY TFFDGPLSGL TLGTGGRYTG SSYGDPANSF KVGSYTVVDA LVRYDLARVG MAGSNVALHV NNLFDREYVA SCFNTYGCFW GAERQVVATA TFRF. It is sometimes possible for the material contained within the vial of "Ferrichrome-iron receptor (fhuA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
