Four and a half LIM domains protein 2 (Fhl2) Recombinant Protein | Fhl2 recombinant protein
Recombinant Rat Four and a half LIM domains protein 2 (Fhl2)
Gene Names
Fhl2; SLIM 3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Four and a half LIM domains protein 2 (Fhl2); Recombinant Rat Four and a half LIM domains protein 2 (Fhl2); Fhl2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-279, Full length protein
Sequence
MTERFDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYRDQPWHRECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Sequence Length
279
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,087 Da
NCBI Official Full Name
four and a half LIM domains protein 2
NCBI Official Synonym Full Names
four and a half LIM domains 2
NCBI Official Symbol
Fhl2
NCBI Official Synonym Symbols
SLIM 3
NCBI Protein Information
four and a half LIM domains protein 2
UniProt Protein Name
Four and a half LIM domains protein 2
Protein Family
UniProt Gene Name
Fhl2
UniProt Synonym Gene Names
Dral; Slim3; FHL-2; SLIM-3
NCBI Description
involved in cellular signaling by interacting with endogenous PS2 [RGD, Feb 2006]
Uniprot Description
May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation ().
Research Articles on Fhl2
Similar Products
Product Notes
The Fhl2 fhl2 (Catalog #AAA1015214) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-279, Full length protein. The amino acid sequence is listed below: MTERFDCHHC NESLYGKKYI LKEENPHCVA CFEELYANTC EECGTPIGCD CKDLSYKDRH WHEGCFHCSR CGSSLVDKPF AAKEEQLLCT DCYSNEYSSK CQECKKTIMP GTRKMEYKGS SWHETCFTCQ RCQQPIGTKS FIPKENQNFC VPCYEKQYAL QCVQCKKPIT TGGVTYRDQP WHRECFVCTA CKKQLSGQRF TARDEFPYCL TCFCDLYAKK CAGCTNPISG LGGTKYISFE ERQWHNDCFN CKKCSLSLVG RGFLTERDDI LCPDCGKDI. It is sometimes possible for the material contained within the vial of "Four and a half LIM domains protein 2 (Fhl2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
