Fibrinogen-like protein 1 (FGL1) Recombinant Protein | FGL1 recombinant protein
Recombinant Bovine Fibrinogen-like protein 1 (FGL1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibrinogen-like protein 1 (FGL1); Recombinant Bovine Fibrinogen-like protein 1 (FGL1); FGL1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-312, full length protein
Sequence
LENCLQEQARLRAQVYLLETRVKQQQVKISQLLHEKQVQLLDKGEENSVIDLGGKRQYADCSEIFNDGYKQSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRDWSDYENGFGNFVQKNGEYWLGNRNLHLLTTQGDYTLKIDLADFEKNSRYAQYKNFKVGDEKNSYDLHIGEYSGTAGDSLTGNFHPEVQWWASHQRMKFSTWDRDNDNYEGNCAKEDQSGWWFNRCHSANLNGFYHKGPYTAKTDNGIVWHTWHGWWYSLKSVVMKIRPNDFIPNIV
Sequence Length
290
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for FGL1 recombinant protein
Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,139 Da
NCBI Official Full Name
fibrinogen-like protein 1
NCBI Official Synonym Full Names
fibrinogen like 1
NCBI Official Symbol
FGL1
NCBI Protein Information
fibrinogen-like protein 1
UniProt Protein Name
Fibrinogen-like protein 1
Protein Family
UniProt Gene Name
FGL1
Uniprot Description
Has hepatocyte mitogenic activity.
Similar Products
Product Notes
The FGL1 fgl1 (Catalog #AAA1379361) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-312, full length protein. The amino acid sequence is listed below: LENCLQEQAR LRAQVYLLET RVKQQQVKIS QLLHEKQVQL LDKGEENSVI DLGGKRQYAD CSEIFNDGYK QSGFYKIKPL QSPAEFSVYC DMSDGGGWTV IQRRSDGSEN FNRDWSDYEN GFGNFVQKNG EYWLGNRNLH LLTTQGDYTL KIDLADFEKN SRYAQYKNFK VGDEKNSYDL HIGEYSGTAG DSLTGNFHPE VQWWASHQRM KFSTWDRDND NYEGNCAKED QSGWWFNRCH SANLNGFYHK GPYTAKTDNG IVWHTWHGWW YSLKSVVMKI RPNDFIPNIV. It is sometimes possible for the material contained within the vial of "Fibrinogen-like protein 1 (FGL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
