Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Keratinocyte growth factor (FGF7) Recombinant Protein | FGF7 recombinant protein

Recombinant Human Keratinocyte growth factor (FGF7), partial

Gene Names
FGF7; KGF; HBGF-7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Keratinocyte growth factor (FGF7); Recombinant Human Keratinocyte growth factor (FGF7); partial; Heparin-binding growth factor 7; FGF7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
34-189aa
Sequence
DMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFL
Sequence Length
Partial
Organism
Homo sapiens (Human)
Tag Information
N-terminal 6xHis-B2M-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

SDS-Page
Related Product Information for FGF7 recombinant protein
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Product Categories/Family for FGF7 recombinant protein
References
"Human KGF is FGF-related with properties of a paracrine effector of epithelial cell growth." Finch P.W., Rubin J.S., Miki T., Ron D., Aaronson S.A.Science 245:752-755 (1989)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.2 kDa
NCBI Official Full Name
fibroblast growth factor 7
NCBI Official Synonym Full Names
fibroblast growth factor 7
NCBI Official Symbol
FGF7
NCBI Official Synonym Symbols
KGF; HBGF-7
NCBI Protein Information
fibroblast growth factor 7
UniProt Protein Name
Fibroblast growth factor 7
Protein Family
UniProt Gene Name
FGF7
UniProt Synonym Gene Names
KGF; FGF-7; HBGF-7

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.

Research Articles on FGF7

Similar Products

Product Notes

The FGF7 fgf7 (Catalog #AAA7110852) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-189aa with tag N-terminal 6xHis-B2M-tagged. The amino acid sequence is listed below: DMTPEQMATN VNCSSPERHT RSYDYMEGGD IRVRRLFCRT QWYLRIDKRG KVKGTQEMKN NYNIMEIRTV AVGIVAIKGV ESEFYLAMNK EGKLYAKKEC NEDCNFKELI LENHYNTYAS AKWTHNGGEM FVALNQKGIP VRGKKTKKEQ KTAHFL. It is sometimes possible for the material contained within the vial of "Keratinocyte growth factor (FGF7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.