Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Fibroblast growth factor 19 Recombinant Protein | FGF-19 recombinant protein

Recombinant Human Fibroblast growth factor 19 protein

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast growth factor 19; Recombinant Human Fibroblast growth factor 19 protein; FGF-19 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
32-216aa; Partial
Sequence
PHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Sequence Length
216
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for FGF-19 recombinant protein
Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.
Product Categories/Family for FGF-19 recombinant protein
References
Structure and expression of a novel human FGF, FGF-19, expressed in the fetal brain.Nishimura T., Utsunomiya Y., Hoshikawa M., Ohuchi H., Itoh N.Biochim. Biophys. Acta 1444:148-151(1999)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.8 kDa
NCBI Official Full Name
fibroblast growth factor 19
NCBI Official Synonym Full Names
fibroblast growth factor 19
NCBI Official Symbol
FGF19
NCBI Protein Information
fibroblast growth factor 19
UniProt Protein Name
Fibroblast growth factor 19
Protein Family
UniProt Gene Name
FGF19
UniProt Synonym Gene Names
FGF-19
UniProt Entry Name
FGF19_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF19: Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4. Belongs to the heparin-binding growth factors family.

Protein type: Cell development/differentiation; Secreted; Cytokine; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q13.1

Cellular Component: extracellular region; intracellular

Molecular Function: fibroblast growth factor receptor binding; growth factor activity; protein binding

Biological Process: activation of MAPKK activity; axon guidance; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; heart development; innate immune response; insulin receptor signaling pathway; MAPKKK cascade; nerve growth factor receptor signaling pathway; nervous system development; neural crest cell migration; phosphoinositide-mediated signaling; positive regulation of cell proliferation; positive regulation of glucose import; positive regulation of JNK cascade; positive regulation of protein amino acid phosphorylation; Ras protein signal transduction; small GTPase mediated signal transduction; vascular endothelial growth factor receptor signaling pathway

Research Articles on FGF-19

Similar Products

Product Notes

The FGF-19 fgf19 (Catalog #AAA1265519) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-216aa; Partial. The amino acid sequence is listed below: PHVHYGWGDP IRLRHLYTSG PHGLSSCFLR IRADGVVDCA RGQSAHSLLE IKAVALRTVA IKGVHSVRYL CMGADGKMQG LLQYSEEDCA FEEEIRPDGY NVYRSEKHRL PVSLSSAKQR QLYKNRGFLP LSHFLPMLPM VPEEPEDLRG HLESDMFSSP LETDSMDPFG LVTGLEAVRS PSFEK. It is sometimes possible for the material contained within the vial of "Fibroblast growth factor 19, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.