Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Fibroblast growth factor 10 Recombinant Protein | FGF10 recombinant protein

Recombinant Human Fibroblast growth factor 10

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast growth factor 10; Recombinant Human Fibroblast growth factor 10; Keratinocyte growth factor 2; FGF10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
37-208aa; Partial
Sequence
CQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
Sequence Length
208
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for FGF10 recombinant protein
Plays an important role in the regulation of emembryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.
Product Categories/Family for FGF10 recombinant protein
References
"Structure and expression of human fibroblast growth factor-10." Emoto H., Tagashira S., Mattei M.-G., Yamasaki M., Hashimoto G., Katsumata T., Negoro T., Nakatsuka M., Birnbaum D., Coulier F., Itoh N. J. Biol. Chem. 272:23191-23194(1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.4 kDa
NCBI Official Full Name
fibroblast growth factor 10
NCBI Official Synonym Full Names
fibroblast growth factor 10
NCBI Official Symbol
FGF10
NCBI Protein Information
fibroblast growth factor 10
UniProt Protein Name
Fibroblast growth factor 10
Protein Family
UniProt Gene Name
FGF10
UniProt Synonym Gene Names
FGF-10
UniProt Entry Name
FGF10_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF10: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing. Interacts with FGFR1 and FGFR2. Interacts with FGFBP1. Belongs to the heparin-binding growth factors family.

Protein type: Secreted, signal peptide; Cell development/differentiation; Motility/polarity/chemotaxis; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 5p13-p12

Cellular Component: cell surface; extracellular matrix; extracellular region; extracellular space; nucleus; plasma membrane

Molecular Function: chemoattractant activity; fibroblast growth factor receptor binding; growth factor activity; heparin binding; protein binding; type 2 fibroblast growth factor receptor binding

Biological Process: actin cytoskeleton reorganization; activation of MAPK activity; activation of MAPKK activity; angiogenesis; axon guidance; blood vessel remodeling; branching morphogenesis of a tube; determination of left/right symmetry; embryonic camera-type eye development; embryonic digestive tract morphogenesis; embryonic genitalia morphogenesis; embryonic pattern specification; epidermal growth factor receptor signaling pathway; epithelial cell proliferation; establishment of mitotic spindle orientation; female genitalia morphogenesis; fibroblast growth factor receptor signaling pathway; G1/S-specific positive regulation of cyclin-dependent protein kinase activity; hair follicle morphogenesis; induction of an organ; induction of positive chemotaxis; innate immune response; insulin receptor signaling pathway; keratinocyte proliferation; lacrimal gland development; limb bud formation; male genitalia morphogenesis; MAPKKK cascade; mesonephros development; metanephros development; muscle cell fate commitment; negative regulation of cell differentiation; negative regulation of cell proliferation; nerve growth factor receptor signaling pathway; odontogenesis of dentine-containing teeth; otic vesicle formation; pancreas development; phosphoinositide-mediated signaling; pituitary gland development; positive chemotaxis; positive regulation of ATPase activity; positive regulation of DNA repair; positive regulation of DNA replication; positive regulation of epithelial cell proliferation; positive regulation of epithelial cell proliferation involved in wound healing; positive regulation of fibroblast proliferation; positive regulation of keratinocyte migration; positive regulation of lymphocyte proliferation; positive regulation of MAPKKK cascade; positive regulation of mitotic cell cycle; positive regulation of Notch signaling pathway; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of Ras protein signal transduction; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; positive regulation of urothelial cell proliferation; positive regulation of vascular endothelial growth factor receptor signaling pathway; radial glial cell differentiation; Ras protein signal transduction; regulation of activin receptor signaling pathway; regulation of saliva secretion; regulation of smoothened signaling pathway; response to estradiol stimulus; response to lipopolysaccharide; salivary gland development; small GTPase mediated signal transduction; smooth muscle cell differentiation; somatic stem cell maintenance; spleen development; thymus development; thyroid gland development; tissue regeneration; urothelial cell proliferation; vascular endothelial growth factor receptor signaling pathway; white fat cell differentiation; wound healing

Disease: Aplasia Of Lacrimal And Salivary Glands; Lacrimoauriculodentodigital Syndrome

Research Articles on FGF10

Similar Products

Product Notes

The FGF10 fgf10 (Catalog #AAA969520) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 37-208aa; Partial. The amino acid sequence is listed below: CQALGQDMVS PEATNSSSSS FSSPSSAGRH VRSYNHLQGD VRWRKLFSFT KYFLKIEKNG KVSGTKKENC PYSILEITSV EIGVVAVKAI NSNYYLAMNK KGKLYGSKEF NNDCKLKERI EENGYNTYAS FNWQHNGRQM YVALNGKGAP RRGQKTRRKN TSAHFLPMVV HS. It is sometimes possible for the material contained within the vial of "Fibroblast growth factor 10, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.