Ferric enterobactin transport protein fepE (fepE) Recombinant Protein | fepE recombinant protein
Recombinant Escherichia coli Ferric enterobactin transport protein fepE (fepE)
Gene Names
fepE; ECK0580; JW0579
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ferric enterobactin transport protein fepE (fepE); Recombinant Escherichia coli Ferric enterobactin transport protein fepE (fepE); Recombinant Ferric enterobactin transport protein fepE (fepE); Ferric enterobactin transport protein fepE; fepE recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-377
Sequence
MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMAVVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKSFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKKDEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISTLVVKESLENVRNKLEIKTQFEKEKLAQDRIKTKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKAHVNDVNFTPFKYQLSPSLPVKKDGPGKAIIVILSALIGGMVACGGVLLRYAMASRKQDAMMADHLV
Sequence Length
377
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,100 Da
NCBI Official Full Name
regulator of length of O-antigen component of lipopolysaccharide chains
NCBI Official Symbol
fepE
NCBI Official Synonym Symbols
ECK0580; JW0579
NCBI Protein Information
regulator of length of O-antigen component of lipopolysaccharide chains
UniProt Protein Name
Ferric enterobactin transport protein FepE
Protein Family
UniProt Gene Name
fepE
UniProt Entry Name
FEPE_ECOLI
NCBI Description
FepE is believed to be a component of the ferric enterobactin transport system, because mutation of fepE disrupts uptake of enterobactin . [More information is available at EcoCyc: EG10297].
Uniprot Description
Function: Part of the ferric enterobactin transport system.
Subcellular location: Cell inner membrane; Multi-pass membrane protein.
Induction: Repressed by H-NS, induced by LeuO. A monocistronic operon. Ref.7
Sequence similarities: Belongs to the WzzB/Cld/Rol family.
Similar Products
Product Notes
The fepE fepe (Catalog #AAA1231010) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-377. The amino acid sequence is listed below: MSSLNIKQGS DAHFPDYPLA SPSNNEIDLL NLISVLWRAK KTVMAVVFAF ACAGLLISFI LPQKWTSAAV VTPPEPVQWQ ELEKSFTKLR VLDLDIKIDR TEAFNLFIKK FQSVSLLEEY LRSSPYVMDQ LKEAKIDELD LHRAIVALSE KMKAVDDNAS KKKDEPSLYT SWTLSFTAPT SEEAQTVLSG YIDYISTLVV KESLENVRNK LEIKTQFEKE KLAQDRIKTK NQLDANIQRL NYSLDIANAA GIKKPVYSNG QAVKDDPDFS ISLGADGIER KLEIEKAVTD VAELNGELRN RQYLVEQLTK AHVNDVNFTP FKYQLSPSLP VKKDGPGKAI IVILSALIGG MVACGGVLLR YAMASRKQDA MMADHLV. It is sometimes possible for the material contained within the vial of "Ferric enterobactin transport protein fepE (fepE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
