Elongation of fatty acids protein 2 (FEN1) Recombinant Protein | FEN1 recombinant protein

Recombinant Saccharomyces cerevisiae Elongation of fatty acids protein 2 (FEN1)

• Gene Names: FEN1; ELO2; GNS1; VBM2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Elongation of fatty acids protein 2 (FEN1); Recombinant Saccharomyces cerevisiae Elongation of fatty acids protein 2 (FEN1); Recombinant Elongation of fatty acids protein 2 (FEN1); Elongation of fatty acids protein 2 EC= 2.3.1.n8; 3-keto acyl-CoA synthase ELO2 Protein GNS1 v-SNARE bypass mutant gene 2 protein; FEN1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-347
• Sequence: MNSLVTQYAAPLFERYPQLHDYLPTLERPFFNISLWEHFDDVVTRVTNGRFVPSEFQFIAGELPLSTLPPVLYAITAYYVIIFGGRFLLSKSKPFKLNGLFQLHNLVLTSLSLTLLLLMVEQLVPIIVQHGLYFAICNIGAWTQPLVTLYYMNYIVKFIEFIDTFFLVLKHKKLTFLHTYHHGATALLCYTQLMGTTSISWVPISLNLGVHVVMYWYYFLAARGIRVWWKEWVTRFQIIQFVLDIGFIYFAVYQKAVHLYFPILPHCGDCVGSTTATFAGCAIISSYLVLFISFYINVYKRKGTKTSRVVKRAHGGVAAKVNEYVNVDLKNVPTPSPSPKPQHRRKR
• Sequence Length: 347

• Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 6319882
• NCBI GeneID: 850400
• NCBI Accession #: NP_009963.1
• NCBI GenBank Nucleotide #: NM_001178748.1
• UniProt Accession #: P25358; D6VR44
• Molecular Weight: 40,002 Da
• NCBI Official Full Name: Fen1p
• NCBI Official Symbol: FEN1
• NCBI Official Synonym Symbols: ELO2; GNS1; VBM2
• NCBI Protein Information: Fen1p
• UniProt Protein Name: Elongation of fatty acids protein 2
• UniProt Gene Name: FEN1
• UniProt Synonym Gene Names: ELO2; GNS1; VBM2
• UniProt Entry Name: ELO2_YEAST

Uniprot Description

Function: Involved in synthesis of 1,3-beta-glucan. Could be a subunit of 1,3-beta-glucan synthase. Could be also a component of the membrane bound fatty acid elongation systems that produce the 26-carbon very long chain fatty acids that are precursors for ceramide and sphingolipids. Appears to be involved in the elongation of fatty acids up to 24 carbons. Appears to have the highest affinity for substrates with chain length less than 22 carbons.

Catalytic activity: A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO2.

Subcellular location: Membrane; Multi-pass membrane protein.

Miscellaneous: Present with 3510 molecules/cell in log phase SD medium.

Sequence similarities: Belongs to the ELO family.