Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE (12% SDS-PAGE:)

FCN3 / Ficolin-3 Recombinant Protein | FCN3 recombinant protein

Human FCN3 / Ficolin-3 Recombinant Protein

Gene Names
FCN3; FCNH; HAKA1
Applications
ELISA, Western Blot
Purity
>90%
Synonyms
FCN3 / Ficolin-3; Human FCN3 / Ficolin-3 Recombinant Protein; Ficolin-3; Collagen/fibrinogen domain-containing lectin 3 p35; Collagen/fibrinogen domain-containing protein 3; Hakata antigen; FCNH; HAKA1; FCN3 recombinant protein
Ordering
Host
E. coli
Purity/Purification
>90%
Form/Format
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole, 10%glycerol (PH8.0)
Concentration
0.5mg/mL (varies by lot)
Sequence
QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGDWASGRGVGHPYRRVRMMLR
Applicable Applications for FCN3 recombinant protein
ELISA (EIA), Western Blot (WB), Antigen Protein (AP)
Organism
Homo sapiens(human)
Preparation and Storage
Store at -20°C. (Avoid repeated freezing and thawing.)

SDS-PAGE

(12% SDS-PAGE:)

SDS-PAGE (12% SDS-PAGE:)
Related Product Information for FCN3 recombinant protein
Recombinant protein with His-tag

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.30KD
NCBI Official Full Name
ficolin-3 isoform 1
NCBI Official Synonym Full Names
ficolin 3
NCBI Official Symbol
FCN3
NCBI Official Synonym Symbols
FCNH; HAKA1
NCBI Protein Information
ficolin-3
UniProt Protein Name
Ficolin-3
Protein Family
UniProt Gene Name
FCN3
UniProt Synonym Gene Names
FCNH; HAKA1
UniProt Entry Name
FCN3_HUMAN

NCBI Description

Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglycoprotein found in all human serum and is a member of the ficolin/opsonin p35 lectin family. The protein, which was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus, has been shown to have a calcium-independent lectin activity. The protein can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway. Alternative splicing occurs at this locus and two variants, each encoding a distinct isoform, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

FCN3: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc- binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota. Defects in FCN3 are the cause of ficolin 3 deficiency (FCN3D). FCN3D is a disorder characterized by immunodeficiency, recurrent infections, brain abscesses and recurrent warts on the fingers. Affected individuals have normal levels of lymphocytes, normal T-cell responses, and normal antibodies, but a selective deficient antibody response to pneumococcal polysaccharide vaccine. Belongs to the ficolin lectin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: collagen; extracellular region

Molecular Function: protein binding; carbohydrate binding; antigen binding

Biological Process: negative regulation of virion penetration into host cell; innate immune response; complement activation, lectin pathway; defense response to virus; recognition of apoptotic cell; complement activation

Disease: Immunodeficiency Due To Ficolin 3 Deficiency

Research Articles on FCN3

Similar Products

Product Notes

The FCN3 fcn3 (Catalog #AAA2903058) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FCN3 / Ficolin-3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Antigen Protein (AP). Researchers should empirically determine the suitability of the FCN3 fcn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QEHPSCPGPR ELEASKVVLL PSCPGAPGSP GEKGAPGPQG PPGPPGKMGP KGEPGDPVNL LRCQEGPRNC RELLSQGATL SGWYHLCLPE GRALPVFCDM DTEGGGWLVF QRRQDGSVDF FRSWSSYAGF GNQESEFWLG NENLHQLTLQ GNWELRVELE DFNGNRTFAH YATFRLLGEV DHYQLALGKF SEGTAGDSLS LHSGRPFTTY DADHDSSNSN CAVIVHGAWW YASCYRSNLN GRYAVSEAAA HKYGDWASGR GVGHPYRRVR MMLR. It is sometimes possible for the material contained within the vial of "FCN3 / Ficolin-3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.