SDS-Page
IgG receptor FcRn large subunit p51 (FCGRT) Recombinant Protein | FCGRT recombinant protein
Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial
Gene Names
FCGRT; FCRN; alpha-chain
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
IgG receptor FcRn large subunit p51 (FCGRT); Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT); partial; IgG Fc fragment receptor transporter alpha chain; Neonatal Fc receptor; FCGRT recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-297aa; Extracellular Domain
Sequence
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
Sequence Length
297
Production Note
Special Offer: The E Coli, Mammalian-Cell host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Mammalian-Cellhost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Mammalian-Cell host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Mammalian-Cell host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Related Product Information for FCGRT recombinant protein
Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
Product Categories/Family for FCGRT recombinant protein
References
A major histocompatibility complex class I-like Fc receptor cloned from human placenta
possible role in transfer of immunoglobulin G from mother to fetus.Story C.M., Mikulska J., Simister N.E.J. Exp. Med. 180:2377-2381(1994)
Partial sequence of the human fcgrt gene and its 5' upstream region.Tiwari B., Junghans R.P.Cloning and analysis of the gene encoding the human neonatal Fc receptor.Mikulska J.E., Pablo L., Canel J., Simister N.E.Eur. J. Immunogenet. 27:231-240(2000)
The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32.4 kDa
NCBI Official Full Name
IgG receptor FcRn large subunit p51
NCBI Official Synonym Full Names
Fc fragment of IgG receptor and transporter
NCBI Official Symbol
FCGRT
NCBI Official Synonym Symbols
FCRN; alpha-chain
NCBI Protein Information
IgG receptor FcRn large subunit p51
UniProt Protein Name
IgG receptor FcRn large subunit p51
Protein Family
UniProt Gene Name
FCGRT
UniProt Synonym Gene Names
FCRN; FcRn
UniProt Entry Name
FCGRN_HUMAN
NCBI Description
This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Uniprot Description
FCGRT: Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus. Belongs to the immunoglobulin superfamily.
Protein type: Immunoglobulin superfamily; Membrane protein, integral; Receptor, misc.
Chromosomal Location of Human Ortholog: 19q13.3
Cellular Component: integral to membrane; plasma membrane
Molecular Function: antigen binding; beta-2-microglobulin binding; IgG binding; IgG receptor activity; peptide antigen binding
Biological Process: antigen processing and presentation; IgG immunoglobulin transcytosis in epithelial cells mediated by FcRn immunoglobulin receptor; immune response
Research Articles on FCGRT
Similar Products
Product Notes
The FCGRT fcgrt (Catalog #AAA948846) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-297aa; Extracellular Domain. The amino acid sequence is listed below: AESHLSLLYH LTAVSSPAPG TPAFWVSGWL GPQQYLSYNS LRGEAEPCGA WVWENQVSWY WEKETTDLRI KEKLFLEAFK ALGGKGPYTL QGLLGCELGP DNTSVPTAKF ALNGEEFMNF DLKQGTWGGD WPEALAISQR WQQQDKAANK ELTFLLFSCP HRLREHLERG RGNLEWKEPP SMRLKARPSS PGFSVLTCSA FSFYPPELQL RFLRNGLAAG TGQGDFGPNS DGSFHASSSL TVKSGDEHHY CCIVQHAGLA QPLRVELESP AKSS. It is sometimes possible for the material contained within the vial of "IgG receptor FcRn large subunit p51 (FCGRT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
