Low affinity immunoglobulin epsilon Fc receptor Recombinant Protein | FCER2 recombinant protein

Recombinant Human Low affinity immunoglobulin epsilon Fc receptor

Cat. Num. AAA967272

• Gene Names: FCER2; CD23; FCE2; CD23A; IGEBF; CLEC4J; BLAST-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Low affinity immunoglobulin epsilon Fc receptor; Recombinant Human Low affinity immunoglobulin epsilon Fc receptor; BLAST-2; C-type lectin domain family 4 member JFc-epsilon-RII; Immunoglobulin E-binding factor; Lymphocyte IgE receptor; CD23; FCER2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 48-321aa; Extracellular Domain
• Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
• Sequence Length: 320

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for FCER2 recombinant protein

Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).

Product Categories/Family for FCER2 recombinant protein

Immunology

References

Human lymphocyte Fc receptor for IgE sequence homology of its cloned cDNA with animal lectins.Ikuta K., Takami M., Kim C.W., Honjo T., Miyoshi T., Tagaya Y., Kawabe T., Yodoi J.Proc. Natl. Acad. Sci. U.S.A. 84:819-823(1987) Molecular structure of human lymphocyte receptor for immunoglobulin E.Kikutani H., Inui S., Sato R., Barsumian E.L., Owaki H., Yamasaki K., Kaisho T., Uchibayashi N., Hardy R.R., Hirano T., Tsunasawa S., Sakiyama F., Suemura M., Kishimoto T.Cell 47:657-665(1986) Cloning and expression of the cDNA coding for a human lymphocyte IgE receptor.Luedin C., Hofstetter H., Sarfati M., Levy C.A., Suter U., Alaimo D., Kilchherr E., Frost H., Delespesse G.EMBO J. 6:109-114(1987) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004) Two species of human Fc epsilon receptor II (Fc epsilon RII/CD23) tissue-specific and IL-4-specific regulation of gene expression.Yokota A., Kikutani H., Tanaka T., Sato R., Barsumian E.L., Suemura M., Kishimoto T.Cell 55:611-618(1988) Partial characterization of natural and recombinant human soluble CD23.Rose K., Turcatti G., Graber P., Pochon S., Regamey P.-O., Jansen K.U., Magnenat E., Aubonney N., Bonnefoy J.-Y.Biochem. J. 286:819-824(1992) The low affinity IgE receptor (CD23) is cleaved by the metalloproteinase ADAM10.Lemieux G.A., Blumenkron F., Yeung N., Zhou P., Williams J., Grammer A.C., Petrovich R., Lipsky P.E., Moss M.L., Werb Z.J. Biol. Chem. 282:14836-14844(2007) Proteomic analysis of S-acylated proteins in human B cells reveals palmitoylation of the immune regulators CD20 and CD23.Ivaldi C., Martin B.R., Kieffer-Jaquinod S., Chapel A., Levade T., Garin J., Journet A.PLoS ONE 7:E37187-E37187(2012) Modeling of the lectin-homology domains of the human and murine low-affinity Fc epsilon receptor (Fc epsilon RII/CD23) .Padlan E.A., Helm B.A.Receptor 3:325-341(1993) Structure-based modeling of the ligand binding domain of the human cell surface receptor CD23 and comparison of two independently derived molecular models.Bajorath J., Aruffo A.Protein Sci. 5:240-247(1996) The structure of human CD23 and its interactions with IgE and CD21.Hibbert R.G., Teriete P., Grundy G.J., Beavil R.L., Reljic R., Holers V.M., Hannan J.P., Sutton B.J., Gould H.J., McDonnell J.M.J. Exp. Med. 202:751-760(2005) Structural changes in the lectin domain of CD23, the low-affinity IgE receptor, upon calcium binding.Wurzburg B.A., Tarchevskaya S.S., Jardetzky T.S.Structure 14:1049-1058(2006) Mutations in the autoregulatory domain of beta-tubulin 4a cause hereditary dystonia.Hersheson J., Mencacci N.E., Davis M., Macdonald N., Trabzuni D., Ryten M., Pittman A., Paudel R., Kara E., Fawcett K., Plagnol V., Bhatia K.P., Medlar A.J., Stanescu H.C., Hardy J., Kleta R., Wood N.W., Houlden H.Ann. Neurol. 73:546-553(2013)

NCBI and Uniprot Product Information

• NCBI GI #: 334085205
• NCBI GeneID: 2208
• NCBI Accession #: NP_001193948.2
• NCBI GenBank Nucleotide #: NM_001207019.2
• UniProt Accession #: P06734
• Molecular Weight: 33.2
• NCBI Official Full Name: low affinity immunoglobulin epsilon Fc receptor isoform b
• NCBI Official Synonym Full Names: Fc fragment of IgE receptor II
• NCBI Official Symbol: FCER2
• NCBI Official Synonym Symbols: CD23; FCE2; CD23A; IGEBF; CLEC4J; BLAST-2
• NCBI Protein Information: low affinity immunoglobulin epsilon Fc receptor
• UniProt Protein Name: Low affinity immunoglobulin epsilon Fc receptor
• Protein Family: Low affinity immunoglobulin epsilon Fc receptor
• UniProt Gene Name: FCER2
• UniProt Synonym Gene Names: CD23A; CLEC4J; FCE2; IGEBF
• UniProt Entry Name: FCER2_HUMAN

NCBI Description

The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

Uniprot Description

Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).