Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) Recombinant Protein | FCER1G recombinant protein

Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G), partial

Gene Names
FCER1G; FCRG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G); Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G); partial; Fc receptor gamma-chain; FcRgamma; Fc-epsilon RI-gamma; IgE Fc receptor subunit gamma; FceRI gamma; FCER1G recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
45-86. Partial, provide the complete Cytoplasmic Domain
Sequence
RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Organism
Homo sapiens (Human)
Tag Information
N-terminal 6xHis-B2M-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

SDS-Page
Related Product Information for FCER1G recombinant protein
Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Product Categories/Family for FCER1G recombinant protein
References
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262 (2014)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.9 kDa
NCBI Official Full Name
high affinity immunoglobulin epsilon receptor subunit gamma
NCBI Official Synonym Full Names
Fc fragment of IgE receptor Ig
NCBI Official Symbol
FCER1G
NCBI Official Synonym Symbols
FCRG
NCBI Protein Information
high affinity immunoglobulin epsilon receptor subunit gamma
UniProt Protein Name
High affinity immunoglobulin epsilon receptor subunit gamma
UniProt Gene Name
FCER1G
UniProt Synonym Gene Names
FcRgamma; FceRI gamma

NCBI Description

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]

Uniprot Description

Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.

Research Articles on FCER1G

Similar Products

Product Notes

The FCER1G fcer1g (Catalog #AAA7110850) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 45-86. Partial, provide the complete Cytoplasmic Domain with tag N-terminal 6xHis-B2M-tagged. The amino acid sequence is listed below: RLKIQVRKAA ITSYEKSDGV YTGLSTRNQE TYETLKHEKP PQ. It is sometimes possible for the material contained within the vial of "High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.