F-box/SPRY domain-containing protein 1 (FBXO45) Recombinant Protein | FBXO45 recombinant protein

Recombinant Human F-box/SPRY domain-containing protein 1 (FBXO45)

Cat. Num. AAA966666

• Gene Names: FBXO45; Fbx45
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: F-box/SPRY domain-containing protein 1 (FBXO45); Recombinant Human F-box/SPRY domain-containing protein 1 (FBXO45); FBXO45 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-286, Full length protein
• Sequence: AAPAPGAGAASGGAGCSGGGAGAGAGSGSGAAGAGGRLPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
• Sequence Length: 285

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 157743247
• NCBI GeneID: 200933
• NCBI Accession #: NP_001099043.1
• NCBI GenBank Nucleotide #: NM_001105573.1
• UniProt Accession #: P0C2W1; A6NF90; D3DXB5
• Molecular Weight: 30,633 Da
• NCBI Official Full Name: F-box/SPRY domain-containing protein 1
• NCBI Official Synonym Full Names: F-box protein 45
• NCBI Official Symbol: FBXO45
• NCBI Official Synonym Symbols: Fbx45
• NCBI Protein Information: F-box/SPRY domain-containing protein 1
• UniProt Protein Name: F-box/SPRY domain-containing protein 1
• UniProt Gene Name: FBXO45
• UniProt Synonym Gene Names: FBX45; hFbxo45

NCBI Description

Members of the F-box protein family, such as FBXO45, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (summary by Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Jan 2011]

Uniprot Description

Component of E3 ubiquitin ligase complexes. Required for normal neuromuscular synaptogenesis, axon pathfinding and neuronal migration (). Plays a role in the regulation of neurotransmission at mature neurons (). May control synaptic activity by controlling UNC13A via ubiquitin dependent pathway (). Specifically recognizes TP73, promoting its ubiquitination and degradation.