F-box only protein 22 (FBXO22) Recombinant Protein | FBXO22 recombinant protein

Recombinant Human F-box only protein 22 (FBXO22)

Cat. Num. AAA1466843

• Gene Names: FBXO22; FBX22; FISTC1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: F-box only protein 22 (FBXO22); Recombinant Human F-box only protein 22 (FBXO22); FBXO22 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-403, Full length protein
• Sequence: MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVLRTHRSVTWISAGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK
• Sequence Length: 403

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for FBXO22 recombinant protein

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. This protein belongs to the Fbxs class. Two transcript variants encoding different isoforms exist for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 13443000
• NCBI GeneID: 26263
• NCBI Accession #: NP_036302.1
• NCBI GenBank Nucleotide #: NM_012170.3
• UniProt Accession #: Q8NEZ5; Q0D2P8; Q6PIL5; Q8IXW3; Q9H824; Q9UKC0
• Molecular Weight: 30,589 Da
• NCBI Official Full Name: F-box only protein 22 isoform b
• NCBI Official Synonym Full Names: F-box protein 22
• NCBI Official Symbol: FBXO22
• NCBI Official Synonym Symbols: FBX22; FISTC1
• NCBI Protein Information: F-box only protein 22
• UniProt Protein Name: F-box only protein 22
• Protein Family: F-box only protein
• UniProt Gene Name: FBXO22
• UniProt Synonym Gene Names: FBX22

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and, as a transcriptional target of the tumor protein p53, is thought to be involved in degradation of specific proteins in response to p53 induction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]

Uniprot Description

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Promotes the proteasome-dependent degradation of key sarcomeric proteins, such as alpha-actinin (ACTN2) and filamin-C (FLNC), essential for maintenance of normal contractile function.