Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

F-box only protein 2 (FBXO2) Recombinant Protein | FBXO2 recombinant protein

Recombinant Human F-box only protein 2 (FBXO2)

Gene Names
FBXO2; FBG1; FBX2; Fbs1; OCP1; NFB42
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
F-box only protein 2 (FBXO2); Recombinant Human F-box only protein 2 (FBXO2); F-box only protein 2; FBXO2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-296aa; Full Length
Sequence
MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Sequence Length
296
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for FBXO2 recombinant protein
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Prevents formation of cytosolic aggregates of unfolded glycoproteins that have been retrotranslocated into the cytosol. Able to recognize and bind denatured glycoproteins, preferentially those of the high-mannose type
Product Categories/Family for FBXO2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60.3 kDa
NCBI Official Full Name
F-box only protein 2
NCBI Official Synonym Full Names
F-box protein 2
NCBI Official Symbol
FBXO2
NCBI Official Synonym Symbols
FBG1; FBX2; Fbs1; OCP1; NFB42
NCBI Protein Information
F-box only protein 2; F-box gene 1; organ of Corti protein 1
UniProt Protein Name
F-box only protein 2
Protein Family
UniProt Gene Name
FBXO2
UniProt Synonym Gene Names
FBX2
UniProt Entry Name
FBX2_HUMAN

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is highly similar to the rat NFB42 (neural F Box 42 kDa) protein which is enriched in the nervous system and may play a role in maintaining neurons in a postmitotic state. [provided by RefSeq, Jul 2008]

Uniprot Description

FBXO2: Substrate recognition component of a SCF (SKP1-CUL1-F- box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Prevents formation of cytosolic aggregates of unfolded glycoproteins that have been retrotranslocated into the cytosol. Able to recognize and bind denatured glycoproteins, preferentially those of the high-mannose type.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: endoplasmic reticulum; dendritic spine; SCF ubiquitin ligase complex; cytosol

Molecular Function: beta-amyloid binding; ubiquitin-protein ligase activity; carbohydrate binding; glycoprotein binding

Biological Process: SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; negative regulation of cell proliferation; ER-associated protein catabolic process; regulation of protein ubiquitination; protein ubiquitination; protein modification process; glycoprotein catabolic process; proteolysis

Research Articles on FBXO2

Similar Products

Product Notes

The FBXO2 fbxo2 (Catalog #AAA1334273) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-296aa; Full Length. The amino acid sequence is listed below: MDGDGDPESV GQPEEASPEE QPEEASAEEE RPEDQQEEEA AAAAAYLDEL PEPLLLRVLA ALPAAELVQA CRLVCLRWKE LVDGAPLWLL KCQQEGLVPE GGVEEERDHW QQFYFLSKRR RNLLRNPCGE EDLEGWCDVE HGGDGWRVEE LPGDSGVEFT HDESVKKYFA SSFEWCRKAQ VIDLQAEGYW EELLDTTQPA IVVKDWYSGR SDAGCLYELT VKLLSEHENV LAEFSSGQVA VPQDSDGGGW MEISHTFTDY GPGVRFVRFE HGGQDSVYWK GWFGARVTNS SVWVEP. It is sometimes possible for the material contained within the vial of "F-box only protein 2 (FBXO2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.