CD178 recombinant protein

CD178 Recombinant Protein

Cat. Num. AAA3003512

• Gene Names: FASLG; APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; APT1LG1
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD178; CD178 Recombinant Protein; CD178 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 549
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD178 recombinant protein

Background: Association of the receptor Fas with its ligand FasL triggers an apoptotic pathway that plays an important role in immune regulation, development, and progression of cancers. Loss of function mutation in either Fas (lpr mice) or FasL (gld mice) leads to lymphadenopathy and splenomegaly as a result of decreased apoptosis in CD4-CD8- T lymphocytes. FasL (CD95L, Apo-1L) is a type II transmembrane protein of 280 amino acids (runs at approximately 40 kDa upon glycosylation) that belongs to the TNF family, which also includes TNF-alpha, TRAIL, and TWEAK. Binding of FasL to its receptor triggers the formation of a death-inducing signaling complex (DISC) involving the recruitment of the adaptor protein FADD and caspase-8. Activation of caspase-8 from this complex initiates a caspase cascade resulting in the activation of caspase-3 and subsequent cleavage of proteins leading to apoptosis. Unlike Fas, which is constitutively expressed by various cell types, FasL is predominantly expressed on activated T lymphocytes, NK cells, and at immune privileged sites. FasL is also expressed in several tumor types as a mechanism to evade immune surveillance. Similar to other members of the TNF family, FasL can be cleaved by metalloproteinases producing a 26 kDa trimeric soluble form.

NCBI and Uniprot Product Information

• NCBI GI #: 4557329
• NCBI GeneID: 356
• NCBI Accession #: NP_000630.1
• NCBI GenBank Nucleotide #: NM_000639.1
• UniProt Accession #: P48023; Q9BZP9
• Molecular Weight: 31,485 Da
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 6
• NCBI Official Synonym Full Names: Fas ligand (TNF superfamily, member 6)
• NCBI Official Symbol: FASLG
• NCBI Official Synonym Symbols: APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; APT1LG1
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 6; CD95 ligand; fas antigen ligand; apoptosis antigen ligand; apoptosis (APO-1) antigen ligand 1; tumor necrosis factor (ligand) superfamily, member 6
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 6
• UniProt Gene Name: FASLG
• UniProt Synonym Gene Names: APT1LG1; CD95L; FASL; TNFSF6; APTL; CD95-L; Fas ligand; FasL; sFasL; APL; FasL ICD; SPA
• UniProt Entry Name: TNFL6_HUMAN

NCBI Description

The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). [provided by RefSeq, Jul 2008]

Uniprot Description

FasL: Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects. Homotrimer (Probable). Interacts with ARHGAP9, BAIAP2L1, BTK, CACNB3, CACNB4, CRK, DLG2, DNMBP, DOCK4, EPS8L3, FGR, FYB, FYN, HCK, ITK, ITSN2, KALRN, LYN, MACC1, MIA, MPP4, MYO15A, NCF1, NCK1, NCK2, NCKIPSD, OSTF1, PIK3R1, PSTPIP1, RIMBP3C, SAMSN1, SH3GL3, SH3PXD2B, SH3PXD2A, SH3RF2, SKAP2, SNX33, SNX9, SORBS3, SPTA1, SRC, SRGAP1, SRGAP2, SRGAP3, TEC, TJP3 and YES1. Belongs to the tumor necrosis factor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Membrane protein, integral; Cytokine

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: extracellular space; lysosomal lumen; perinuclear region of cytoplasm; integral to plasma membrane; plasma membrane; extracellular region; caveola; nucleus; external side of plasma membrane

Molecular Function: protein binding; death receptor binding; cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: caspase activation; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; apoptosis; positive regulation of apoptosis; response to lipopolysaccharide; negative regulation of transcription from RNA polymerase II promoter; signal transduction; cellular chloride ion homeostasis; endosomal lumen acidification; inflammatory cell apoptosis; negative regulation of angiogenesis; induction of apoptosis via death domain receptors; cell-cell signaling; positive regulation of neuron apoptosis; positive regulation of epidermal growth factor receptor signaling pathway; positive regulation of cell proliferation; immune response; retinal cell programmed cell death

Disease: Lung Cancer; Autoimmune Lymphoproliferative Syndrome