Fanconi-associated nuclease 1 (Fan1) Recombinant Protein | Fan1 recombinant protein

Recombinant Mouse Fanconi-associated nuclease 1 (Fan1) , partial

Cat. Num. AAA1373336

• Gene Names: Fan1; mFAN1; Mtmr15; 6030441H18Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fanconi-associated nuclease 1 (Fan1); Recombinant Mouse Fanconi-associated nuclease 1 (Fan1); partial; Fan1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 895-1013. Partial.
• Sequence: SAPAESLRAWVGEAWQAQQGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRRLAADFRHCRGGLPDLVVWNSQSHHCKLVEVKGPSDRLSCKQMIWLYELQKLGADVEVCHVVAVG
• Sequence Length: 1013

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 257467664
• NCBI GeneID: 330554
• NCBI Accession #: NP_808561.2
• NCBI GenBank Nucleotide #: NM_177893.3
• UniProt Accession #: Q69ZT1; Q14B88; Q8BVK2
• Molecular Weight: 50,415 Da
• NCBI Official Full Name: fanconi-associated nuclease 1
• NCBI Official Synonym Full Names: FANCD2/FANCI-associated nuclease 1
• NCBI Official Symbol: Fan1
• NCBI Official Synonym Symbols: mFAN1; Mtmr15; 6030441H18Rik
• NCBI Protein Information: fanconi-associated nuclease 1
• UniProt Protein Name: Fanconi-associated nuclease 1
• Protein Family: Fanconi-associated nuclease
• UniProt Gene Name: Fan1
• UniProt Synonym Gene Names: mFAN1

Uniprot Description

Nuclease required for the repair of DNA interstrand cross-links (ICL) recruited at sites of DNA damage by monoubiquitinated FANCD2. Specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombination, probably in the resolution of homologous recombination intermediates (). Not involved in DNA double-strand breaks resection. Acts as a 5'-3' exonuclease that anchors at a cut end of DNA and cleaves DNA successively at every third nucleotide, allowing to excise an ICL from one strand through flanking incisions (PubMed:24981866). Probably keeps excising with 3'-flap annealing until it reaches and unhooks the ICL. Acts at sites that have a 5'-terminal phosphate anchor at a nick or a 1- or 2-nucleotide flap and is augmented by a 3' flap (). Also has endonuclease activity toward 5'-flaps (PubMed:24981866).