3-ketoacyl-CoA synthase 18 (FAE1) Recombinant Protein | FAE1 recombinant protein
Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 18 (FAE1)
Gene Names
KCS18; 3-ketoacyl-CoA synthase 18; FAE1; FATTY ACID ELONGATION1; KCS18; T4L20.100; T4L20_100
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-ketoacyl-CoA synthase 18 (FAE1); Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 18 (FAE1); FAE1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-506aa; full length protein
Sequence
MTSVNVKLLYRYVLTNFFNLCLFPLTAFLAGKASRLTINDLHNFLSYLQHNLITVTLLFA FTVFGLVLYIVTRPNPVYLVDYSCYLPPPHLKVSVSKVMDIFYQIRKADTSSRNVACDDP SSLDFLRKIQERSGLGDETYSPEGLIHVPPRKTFAASREETEKVIIGALENLFENTKVNP REIGILVVNSSMFNPTPSLSAMVVNTFKLRSNIKSFNLGGMGCSAGVIAIDLAKDLLHVH KNTYALVVSTENITQGIYAGENRSMMVSNCLFRVGGAAILLSNKSGDRRRSKYKLVHTVR THTGADDKSFRCVQQEDDESGKIGVCLSKDITNVAGTTLTKNIATLGPLILPLSEKFLFF ATFVAKKLLKDKIKHYYVPDFKLAVDHFCIHAGGRAVIDELEKNLGLSPIDVEASRSTLH RFGNTSSSSIWYELAYIEAKGRMKKGNKAWQIALGSGFKCNSAVWVALRNVKASANSPWQ HCIDRYPVKIDSDLSKSKTHVQNGRS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FAE1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,264 Da
NCBI Official Full Name
3-ketoacyl-CoA synthase 18
NCBI Official Symbol
KCS18
NCBI Official Synonym Symbols
3-ketoacyl-CoA synthase 18; FAE1; FATTY ACID ELONGATION1; KCS18; T4L20.100; T4L20_100
NCBI Protein Information
3-ketoacyl-CoA synthase 18
UniProt Protein Name
3-ketoacyl-CoA synthase 18
Protein Family
UniProt Gene Name
FAE1
UniProt Synonym Gene Names
VLCFA condensing enzyme 18
UniProt Entry Name
KCS18_ARATH
NCBI Description
Encodes KCS18, a member of the 3-ketoacyl-CoA synthase family involved in the biosynthesis of VLCFA (very long chain fatty acids).
Uniprot Description
Contributes to fatty acids elongation and stockage in developing seeds. Active on both saturated and mono-unsaturated acyl-CoAs of 16 and 18 carbons. Required for the elongation of C18 to C20 and of C20 to C22 fatty acids. Mediates also the synthesis of VLCFAs from 20 to 26 carbons in length (e.g. C20:1, C20, C22:1, C22, C24:1, C24, C26) (PubMed:15277688, PubMed:16765910, PubMed:7734965, PubMed:9263455, Ref. 4, Ref. 5, PubMed:12135493, PubMed:23145136). Has no activity with polyunsaturated C18:2 and C18:3 or with acyl-CoAs having 22 carbons or longer chain length (PubMed:12135493).
Research Articles on FAE1
Similar Products
Product Notes
The FAE1 fae1 (Catalog #AAA7014500) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-506aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FAE1 fae1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTSVNVKLLY RYVLTNFFNL CLFPLTAFLA GKASRLTIND LHNFLSYLQH NLITVTLLFA FTVFGLVLYI VTRPNPVYLV DYSCYLPPPH LKVSVSKVMD IFYQIRKADT SSRNVACDDP SSLDFLRKIQ ERSGLGDETY SPEGLIHVPP RKTFAASREE TEKVIIGALE NLFENTKVNP REIGILVVNS SMFNPTPSLS AMVVNTFKLR SNIKSFNLGG MGCSAGVIAI DLAKDLLHVH KNTYALVVST ENITQGIYAG ENRSMMVSNC LFRVGGAAIL LSNKSGDRRR SKYKLVHTVR THTGADDKSF RCVQQEDDES GKIGVCLSKD ITNVAGTTLT KNIATLGPLI LPLSEKFLFF ATFVAKKLLK DKIKHYYVPD FKLAVDHFCI HAGGRAVIDE LEKNLGLSPI DVEASRSTLH RFGNTSSSSI WYELAYIEAK GRMKKGNKAW QIALGSGFKC NSAVWVALRN VKASANSPWQ HCIDRYPVKI DSDLSKSKTH VQNGRS. It is sometimes possible for the material contained within the vial of "3-ketoacyl-CoA synthase 18 (FAE1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
