Fatty acid-binding protein 5 (FABP5) Recombinant Protein | FABP5 recombinant protein

Recombinant Human Fatty acid-binding protein 5 (FABP5)

Cat. Num. AAA7136931

• Gene Names: FABP5; EFABP; KFABP; E-FABP; PAFABP; PA-FABP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fatty acid-binding protein 5 (FABP5); Recombinant Human Fatty acid-binding protein 5 (FABP5); Epidermal-type fatty acid-binding protein1 PublicationE-FABP1 PublicationFatty acid-binding protein; epidermalPsoriasis-associated fatty acid-binding protein homolog; FABP5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-135aa, Full Length
• Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

• Species: Homo sapiens (Human)
• Relevance: Intracellular carrier for long-chain fatty acids and related active lipids, such as the endocannabinoid, that regulates the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors (PubMed:22170058, PubMed:21395585). Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation (By similarity). May be involved in keratinocyte differentiation (PubMed:8092987).
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for FABP5 recombinant protein

Cardiovascular

References

"Solution structure and backbone dynamics of human epidermal-type fatty acid-binding protein (E-FABP)."Gutierrez-Gonzalez L.H., Ludwig C., Hohoff C., Rademacher M., Hanhoff T., Rueterjans H., Spener F., Luecke C.Biochem. J. 364:725-737(2002)

NCBI and Uniprot Product Information

• NCBI GI #: 232081
• NCBI GeneID: 2171
• UniProt Accession #: Q01469; B2R4K0
• Molecular Weight: 15,164 Da
• NCBI Official Full Name: Fatty acid-binding protein, epidermal
• NCBI Official Synonym Full Names: fatty acid binding protein 5 (psoriasis-associated)
• NCBI Official Symbol: FABP5
• NCBI Official Synonym Symbols: EFABP; KFABP; E-FABP; PAFABP; PA-FABP
• NCBI Protein Information: fatty acid-binding protein, epidermal; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog
• UniProt Protein Name: Fatty acid-binding protein, epidermal
• Protein Family: Fatty acid-binding protein
• UniProt Gene Name: FABP5
• UniProt Synonym Gene Names: E-FABP; PA-FABP
• UniProt Entry Name: FABP5_HUMAN

NCBI Description

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]

Uniprot Description

FABP5: High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 8q21.13

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: protein binding; transporter activity; fatty acid binding; lipid binding

Biological Process: epidermis development; phosphatidylcholine biosynthetic process; glucose metabolic process; glucose transport; lipid metabolic process