Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Exenatide Small Molecule | EXT small molecule

BSA Conjugated Exenatide (EXT)

Applications
SDS-Page, Western Blot
Purity
>90%
Synonyms
Exenatide; BSA Conjugated Exenatide (EXT); Byetta; Bydureon; Exendin-4; EXT small molecule
Ordering
For Research Use Only!
Purity/Purification
>90%
Form/Format
Freeze-dried powder
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence Length
87
Applicable Applications for EXT small molecule
Immunogen, SDS-PAGE, Western Blot (WB)
Source
Protein conjugation
Species
General
Tag
N-terminal His Tag
Reconstitution
Reconstitute in PBS or others.
Preparation and Storage
Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months. Avoid repeated freeze/thaw cycles.
Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
NCBI Official Full Name
Exendin-4
UniProt Protein Name
Exendin-4
UniProt Entry Name
EXE4_HELSU

Uniprot Description

Venom protein that mimics the incretin hormone glucagon-like peptide 1 (GLP-1). It stimulates insulin synthesis and secretion, protects against beta-cell apoptosis in response to different insults, and promotes beta-cell proliferation. It also promotes satiety, reduces food intake, reduces fat deposition, reduces body weight and inhibits gastric emptying. Interacts with GLP-1 receptor (GLP1R). Induces hypotension that is mediated by relaxation of cardiac smooth muscle.

Similar Products

Product Notes

The EXT (Catalog #AAA2122419) is a Small Molecule and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Exenatide can be used in a range of immunoassay formats including, but not limited to, Immunogen, SDS-PAGE, Western Blot (WB). Researchers should empirically determine the suitability of the EXT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HGEGTFTSDL SKQMEEEAVR LFIEWLKNGG PSSGAPPPS- NH2. It is sometimes possible for the material contained within the vial of "Exenatide, Small Molecule" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.