Expansin-A20 (EXPA20) Recombinant Protein | EXPA20 recombinant protein

Recombinant Oryza sativa subsp. japonica Expansin-A20 (EXPA20)

Gene Names

LOC4331668; EXP20; EXPA20; OsEXP20; OsEXPA20; OsJ_09463; OsaEXPa1.1

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Expansin-A20 (EXPA20); Recombinant Oryza sativa subsp. japonica Expansin-A20 (EXPA20); EXPA20 recombinant protein

Ordering
Cat. Num. AAA1435754 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

22-240, Full length protein

Sequence

DWLPGTATFYGGADGSGTMGGACGYGNLYDQRYGINNAALSTPLFNDGASCGQCYLIICDYGKAPDWCKLGKAITVTGTNYGGWCNATRPYFDMSQPAWENIGIYSAGIVPILYQQVKCWRYGGVRFIINGFNYFELVLVTNMAGSGSIVSMSVKGSCTGWIQMTRNWGANWQCLAGLAGQALSFNVTSTGGQTIVFDDAVPAGWSFGQTFSTYHQFDY

Sequence Length

219

Species

Oryza sativa subsp. japonica (Rice)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

1002251720

NCBI GeneID

4331668

NCBI Accession #

XP_015630094.1

NCBI GenBank Nucleotide #

XM_015774608.1

UniProt Accession #

Q10RK1; Q0DV16; Q4PR46; Q8LMP8; Q946I2; A0A0P0VT77

Molecular Weight

25,789 Da

NCBI Official Full Name

expansin-A20

NCBI Official Symbol

LOC4331668

NCBI Official Synonym Symbols

EXP20; EXPA20; OsEXP20; OsEXPA20; OsJ_09463; OsaEXPa1.1

NCBI Protein Information

expansin-A20

UniProt Protein Name

Expansin-A20

Protein Family

Expansin

UniProt Gene Name

EXPA20

UniProt Synonym Gene Names

EXP20

Uniprot Description

May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence ().

Similar Products

Product Notes

The EXPA20 expa20 (Catalog #AAA1435754) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-240, Full length protein. The amino acid sequence is listed below: DWLPGTATFY GGADGSGTMG GACGYGNLYD QRYGINNAAL STPLFNDGAS CGQCYLIICD YGKAPDWCKL GKAITVTGTN YGGWCNATRP YFDMSQPAWE NIGIYSAGIV PILYQQVKCW RYGGVRFIIN GFNYFELVLV TNMAGSGSIV SMSVKGSCTG WIQMTRNWGA NWQCLAGLAG QALSFNVTST GGQTIVFDDA VPAGWSFGQT FSTYHQFDY. It is sometimes possible for the material contained within the vial of "Expansin-A20 (EXPA20), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...