Protein FAM176A (FAM176A) Recombinant Protein | FAM176A recombinant protein
Recombinant Human Protein FAM176A (FAM176A)
Gene Names
EVA1A; FAM176A; TMEM166
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein FAM176A (FAM176A); Recombinant Human Protein FAM176A (FAM176A); FAM176A recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-152aa; full length protein
Sequence
MRLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLAALVIRISCH TDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLNKNVFTSAEELER AQRLEERERIIREIWMNGQPEVPGTRSLNRYY
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FAM176A recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,470 Da
NCBI Official Full Name
protein eva-1 homolog A
NCBI Official Synonym Full Names
eva-1 homolog A, regulator of programmed cell death
NCBI Official Symbol
EVA1A
NCBI Official Synonym Symbols
FAM176A; TMEM166
NCBI Protein Information
protein eva-1 homolog A
UniProt Protein Name
Protein eva-1 homolog A
UniProt Gene Name
EVA1A
UniProt Synonym Gene Names
FAM176A; TMEM166
UniProt Entry Name
EVA1A_HUMAN
Uniprot Description
TMEM166: Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. Belongs to the FAM176 family.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 2p12
Cellular Component: endoplasmic reticulum membrane; integral to membrane; intracellular membrane-bound organelle; lysosomal membrane; plasma membrane
Biological Process: apoptosis; autophagy
Research Articles on FAM176A
Similar Products
Product Notes
The FAM176A eva1a (Catalog #AAA7014557) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-152aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FAM176A eva1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRLPLSHSPE HVEMALLSNI LAAYSFVSEN PERAALYFVS GVCIGLVLTL AALVIRISCH TDCRRRPGKK FLQDRESSSD SSDSEDGSED TVSDLSVRRH RRFERTLNKN VFTSAEELER AQRLEERERI IREIWMNGQP EVPGTRSLNR YY. It is sometimes possible for the material contained within the vial of "Protein FAM176A (FAM176A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
