Transforming protein p68/c-ets-1 (ETS1) Recombinant Protein | ETS1 recombinant protein
Recombinant Chicken Transforming protein p68/c-ets-1 (ETS1)
Gene Names
ETS1; p54; ETS-1; EWSR2; TNIP1; ETS-1A; ETS-1B; c-ets-1; c-ets-beta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transforming protein p68/c-ets-1 (ETS1); Recombinant Chicken Transforming protein p68/c-ets-1 (ETS1); ETS1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-485, Full length protein
Sequence
MMSYYMDTTIGSTGPYPLARPGVMQGASSCCEDPWMPCRLQSACCPPRSCCPPWDEAAIQEVPTGLEHYSTDMECADVPLLTPSSKEMMSQALKATFSGFAKEQQRLGIPKDPQQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKECFLELAPDFVGDILWEHLEILQKEEAKPYPANGVNAAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPVQTDSLQTDYFTIKQEVVTPDNMCMGRASRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFQSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADMNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE
Sequence Length
485
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
50,327 Da
NCBI Official Full Name
Transforming protein p68/c-ets-1
NCBI Official Synonym Full Names
v-ets avian erythroblastosis virus E26 oncogene homolog 1
NCBI Official Symbol
ETS1
NCBI Official Synonym Symbols
p54; ETS-1; EWSR2; TNIP1; ETS-1A; ETS-1B; c-ets-1; c-ets-beta
NCBI Protein Information
protein C-ets-1
UniProt Protein Name
Transforming protein p68/c-ets-1
Protein Family
UniProt Gene Name
ETS1
Uniprot Description
Probable transcription factor.
Research Articles on ETS1
Similar Products
Product Notes
The ETS1 ets1 (Catalog #AAA1264978) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-485, Full length protein. The amino acid sequence is listed below: MMSYYMDTTI GSTGPYPLAR PGVMQGASSC CEDPWMPCRL QSACCPPRSC CPPWDEAAIQ EVPTGLEHYS TDMECADVPL LTPSSKEMMS QALKATFSGF AKEQQRLGIP KDPQQWTETH VRDWVMWAVN EFSLKGVDFQ KFCMNGAALC ALGKECFLEL APDFVGDILW EHLEILQKEE AKPYPANGVN AAYPESRYTS DYFISYGIEH AQCVPPSEFS EPSFITESYQ TLHPISSEEL LSLKYENDYP SVILRDPVQT DSLQTDYFTI KQEVVTPDNM CMGRASRGKL GGQDSFESIE SYDSCDRLTQ SWSSQSSFQS LQRVPSYDSF DSEDYPAALP NHKPKGTFKD YVRDRADMNK DKPVIPAAAL AGYTGSGPIQ LWQFLLELLT DKSCQSFISW TGDGWEFKLS DPDEVARRWG KRKNKPKMNY EKLSRGLRYY YDKNIIHKTA GKRYVYRFVC DLQSLLGYTP EELHAMLDVK PDADE. It is sometimes possible for the material contained within the vial of "Transforming protein p68/c-ets-1 (ETS1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
