Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable trans-2-enoyl-CoA reductase, mitochondrial (ETR1) Recombinant Protein | ETR1 recombinant protein

Recombinant Yarrowia lipolytica Probable trans-2-enoyl-CoA reductase, mitochondrial (ETR1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable trans-2-enoyl-CoA reductase; mitochondrial (ETR1); Recombinant Yarrowia lipolytica Probable trans-2-enoyl-CoA reductase; ETR1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
13-376, Full length
Sequence
SGFGTPSFGLRFNSVGRAFVFSQTGEPKDVIQVLEYPIEKPLENQVLLKSLGFTINPADINQLEGVYPSVPPKSVQINNEDAAIGGNEGLFQVLDPGAKSGLKKGDWVLPRKTCFGTWRSHALVEADTVVKIDNTDLTKVQATTVSVNPSTAYEMLKDLKEGDWFIQNGGNSGVGRAAIQIGHIRGLKSISVVRDRPDLEVLKKELTDLGATHVITEEEASDKLFSKQIKSWTGGKIKLALNCIGGKSATSIMRQLGAGGSIVTYGGMSKKPLTFPTGPFIFKDITAKGYWLTRWADKHPEEKAKTIENIFKFYREKKFVAPPVNISTLDFSKGNDVVLSEFLDALGKAQKGGGKKQLVQWVEY
Sequence Length
364
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,206 Da
NCBI Official Full Name
YALI0C19624p
NCBI Official Symbol
YALI0_C19624g
NCBI Protein Information
YALI0C19624p
UniProt Protein Name
Enoyl-[acyl-carrier-protein] reductase, mitochondrial
UniProt Gene Name
ETR1

Uniprot Description

Catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis (fatty acid synthesis type II). Fatty acid chain elongation in mitochondria uses acyl carrier protein (ACP) as an acyl group carrier, but the enzyme accepts both ACP and CoA thioesters as substrates in vitro. Required for respiration and the maintenance of the mitochondrial compartment.

Similar Products

Product Notes

The ETR1 etr1 (Catalog #AAA1395463) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 13-376, Full length. The amino acid sequence is listed below: SGFGTPSFGL RFNSVGRAFV FSQTGEPKDV IQVLEYPIEK PLENQVLLKS LGFTINPADI NQLEGVYPSV PPKSVQINNE DAAIGGNEGL FQVLDPGAKS GLKKGDWVLP RKTCFGTWRS HALVEADTVV KIDNTDLTKV QATTVSVNPS TAYEMLKDLK EGDWFIQNGG NSGVGRAAIQ IGHIRGLKSI SVVRDRPDLE VLKKELTDLG ATHVITEEEA SDKLFSKQIK SWTGGKIKLA LNCIGGKSAT SIMRQLGAGG SIVTYGGMSK KPLTFPTGPF IFKDITAKGY WLTRWADKHP EEKAKTIENI FKFYREKKFV APPVNISTLD FSKGNDVVLS EFLDALGKAQ KGGGKKQLVQ WVEY. It is sometimes possible for the material contained within the vial of "Probable trans-2-enoyl-CoA reductase, mitochondrial (ETR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.