Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Steroid hormone receptor ERR2 (Esrrb) Recombinant Protein | Esrrb recombinant protein

Recombinant Rat Steroid hormone receptor ERR2 (Esrrb)

Gene Names
Esrrb; Err2; Errb
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Steroid hormone receptor ERR2 (Esrrb); Recombinant Rat Steroid hormone receptor ERR2 (Esrrb); Esrrb recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-433, Full length protein
Sequence
MSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGMALGTHANGLDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSENSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPDDVPEGDIKALTTLCDLADRELVFLISWAKHIPGFSNLTLGDQMSLLQSAWMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLELYRAILQLVRRYKKLKVEKEEFVMLKALALANSDSMYIENLEAVQKLQDLLHEALQDYELSQRHEEPRRAGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV
Sequence Length
433
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Esrrb recombinant protein
This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,288 Da
NCBI Official Full Name
steroid hormone receptor ERR2
NCBI Official Synonym Full Names
estrogen-related receptor beta
NCBI Official Symbol
Esrrb
NCBI Official Synonym Symbols
Err2; Errb
NCBI Protein Information
steroid hormone receptor ERR2
UniProt Protein Name
Steroid hormone receptor ERR2
Protein Family
UniProt Gene Name
Esrrb
UniProt Synonym Gene Names
ERR-beta

Uniprot Description

Transcription factor that binds a canonical ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter and enhancer of targets genes regulating their expression or their transcription activity (). Plays a role, in a LIF independent manner, in maintainance of self-renewal and pluripotency of embryonic and trophoblast stem cells through different signaling pathways including FGF signaling pathway and Wnt signaling pathways. Upon FGF signaling pathway activation, interacts with KDM1A by directly binding to enhancer site of ELF5 and EOMES and activating their transcription leading to self-renewal of trophoblast stem cells. Also regulates expression of multiple rod-specific genes and is required for survival of this cell type (). Plays a role as transcription factor activator of GATA6, NR0B1, POU5F1 and PERM1 (). Plays a role as transcription factor repressor of NFE2L2 transcriptional activity and ESR1 transcriptional activity (). During mitosis remains bound to a subset of interphase target genes, including pluripotency regulators, through the canonical ESRRB recognition (ERRE) sequence, leading to their transcriptional activation in early G1 phase. Can coassemble on structured DNA elements with other transcription factors like SOX2, POU5F1, KDM1A and NCOA3 to trigger ESRRB-dependent gene activation. This mechanism, in the case of SOX2 corecruitment prevents the embryonic stem cells (ESCs) to epiblast stem cells (EpiSC) transition through positive regulation of NR0B1 that inhibits the EpiSC transcriptional program. Also plays a role inner ear development by controlling expression of ion channels and transporters and in early placentation ().

Research Articles on Esrrb

Similar Products

Product Notes

The Esrrb esrrb (Catalog #AAA966314) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-433, Full length protein. The amino acid sequence is listed below: MSSEDRHLGS SCGSFIKTEP SSPSSGIDAL SHHSPSGSSD ASGGFGMALG THANGLDSPP MFAGAGLGGN PCRKSYEDCT SGIMEDSAIK CEYMLNAIPK RLCLVCGDIA SGYHYGVASC EACKAFFKRT IQGNIEYSCP ATNECEITKR RRKSCQACRF MKCLKVGMLK EGVRLDRVRG GRQKYKRRLD SENSPYLSLQ ISPPAKKPLT KIVSYLLVAE PDKLYAMPPD DVPEGDIKAL TTLCDLADRE LVFLISWAKH IPGFSNLTLG DQMSLLQSAW MEILILGIVY RSLPYDDKLA YAEDYIMDEE HSRLVGLLEL YRAILQLVRR YKKLKVEKEE FVMLKALALA NSDSMYIENL EAVQKLQDLL HEALQDYELS QRHEEPRRAG KLLLTLPLLR QTAAKAVQHF YSVKLQGKVP MHKLFLEMLE AKV. It is sometimes possible for the material contained within the vial of "Steroid hormone receptor ERR2 (Esrrb), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.