HERV-V_19q13.41 provirus ancestral Env polyprotein 2 (ERVV-2) Recombinant Protein | ERVV-2 recombinant protein
Recombinant Human HERV-V_19q13.41 provirus ancestral Env polyprotein 2 (ERVV-2)
Gene Names
ERVV-2; ENVV2; HERV-V2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HERV-V_19q13.41 provirus ancestral Env polyprotein 2 (ERVV-2); Recombinant Human HERV-V_19q13.41 provirus ancestral Env polyprotein 2 (ERVV-2); ERVV-2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
22-535aa; full length protein
Sequence
QWNENSLVSFSKIIASGNHLSNCWICHNFITRSSSYQYILVRNFSLNLTFGSGIPEGQHK SVPLQVSLANSAHQVPCLDLTPPFNQSSKTSFYFYNCSSLNQTCCPCPEGHCDRKNTSEE GFPSPTIHPMSFSPAGCHPNLTHWCPAKQMNDYRDKSPQNRCAAWEGKELITWRVLYSLP KAHTVPTWPKSTVPLGGPLSPACNQTIPAGWKSQLHKWFDSHIPRWACTPPGYVFLCGPQ KNKLPFDGSPKITYSTPPVANLYTCINNIQHTGECAVGLLGPRGIGVTIYNTTQPRQKRA LGLILAGMGAAIGMIAPWGGFTYHDVTLRNLSRQIDNIAKSTRDSISKLKASIDSLANVV MDNRLALDYLLAEQGGVCAVINKSCCVYVNNSGAIEEDIKKIYDEATWLHDFGKGGASAR AIWEAVKSALPSLNWFVPLLGPATVILLLFLFGPCFFNLLIKCVSSRIKQFHMKSPQMER YQLSVIGGPSTYKHISPLDASGQRFRETMEEFSL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ERVV-2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,317 Da
NCBI Official Full Name
endogenous retrovirus group V member 2 Env polyprotein
NCBI Official Synonym Full Names
endogenous retrovirus group V member 2
NCBI Official Symbol
ERVV-2
NCBI Official Synonym Symbols
ENVV2; HERV-V2
NCBI Protein Information
endogenous retrovirus group V member 2 Env polyprotein
UniProt Protein Name
Endogenous retrovirus group V member 2 Env polyprotein
Protein Family
UniProt Gene Name
ERVV-2
UniProt Synonym Gene Names
ENVV2
UniProt Entry Name
ERVV2_HUMAN
NCBI Description
Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of an HERV provirus on human chromosome 19 that has inactivating mutations in the gag and pol genes. This envelope glycoprotein gene appears to have been selectively preserved. The gene's protein product is expressed in the placenta and acts as a syncytin in Old World monkeys, but has lost the fusogenic activity in humans and other primate lineages. [provided by RefSeq, Jun 2015]
Uniprot Description
ERVV-2: Belongs to the gamma type-C retroviral envelope protein family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: -
Cellular Component: integral to membrane
Similar Products
Product Notes
The ERVV-2 ervv-2 (Catalog #AAA7014390) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-535aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ERVV-2 ervv-2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QWNENSLVSF SKIIASGNHL SNCWICHNFI TRSSSYQYIL VRNFSLNLTF GSGIPEGQHK SVPLQVSLAN SAHQVPCLDL TPPFNQSSKT SFYFYNCSSL NQTCCPCPEG HCDRKNTSEE GFPSPTIHPM SFSPAGCHPN LTHWCPAKQM NDYRDKSPQN RCAAWEGKEL ITWRVLYSLP KAHTVPTWPK STVPLGGPLS PACNQTIPAG WKSQLHKWFD SHIPRWACTP PGYVFLCGPQ KNKLPFDGSP KITYSTPPVA NLYTCINNIQ HTGECAVGLL GPRGIGVTIY NTTQPRQKRA LGLILAGMGA AIGMIAPWGG FTYHDVTLRN LSRQIDNIAK STRDSISKLK ASIDSLANVV MDNRLALDYL LAEQGGVCAV INKSCCVYVN NSGAIEEDIK KIYDEATWLH DFGKGGASAR AIWEAVKSAL PSLNWFVPLL GPATVILLLF LFGPCFFNLL IKCVSSRIKQ FHMKSPQMER YQLSVIGGPS TYKHISPLDA SGQRFRETME EFSL. It is sometimes possible for the material contained within the vial of "HERV-V_19q13.41 provirus ancestral Env polyprotein 2 (ERVV-2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
