SDS-PAGE
Enhancer of rudimentary homolog protein Recombinant Protein | ERH recombinant protein
Recombinant Human Enhancer of rudimentary homolog protein
Gene Names
ERH; DROER
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Enhancer of rudimentary homolog protein; Recombinant Human Enhancer of rudimentary homolog protein; ERH recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-104aa; Full Length
Sequence
SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Sequence Length
104
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for ERH recombinant protein
May have a role in the cell cycle.
Product Categories/Family for ERH recombinant protein
References
Cloning and mapping of a novel human cDNA homologous to DROER, the enhancer of the Drosophila melanogaster rudimentary gene.Isomura M., Okui K., Fujiwara T., Shin S., Nakamura Y.Genomics 32:125-127(1996)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39.1 kDa
NCBI Official Full Name
enhancer of rudimentary homolog
NCBI Official Synonym Full Names
enhancer of rudimentary homolog (Drosophila)
NCBI Official Symbol
ERH
NCBI Official Synonym Symbols
DROER
NCBI Protein Information
enhancer of rudimentary homolog
UniProt Protein Name
Enhancer of rudimentary homolog
Protein Family
UniProt Gene Name
ERH
UniProt Entry Name
ERH_HUMAN
Uniprot Description
ERH: May have a role in the cell cycle. Belongs to the E(R) family.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 14q24.1
Cellular Component: membrane; midbody
Molecular Function: methyl-CpG binding; protein binding
Biological Process: cell cycle; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; osteoblast differentiation; positive regulation of Notch signaling pathway; pyrimidine nucleoside metabolic process; pyrimidine nucleotide biosynthetic process
Research Articles on ERH
Similar Products
Product Notes
The ERH erh (Catalog #AAA717204) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-104aa; Full Length. The amino acid sequence is listed below: SHTILLVQPT KRPEGRTYAD YESVNECMEG VCKMYEEHLK RMNPNSPSIT YDISQLFDFI DDLADLSCLV YRADTQTYQP YNKDWIKEKI YVLLRRQAQQ AGK. It is sometimes possible for the material contained within the vial of "Enhancer of rudimentary homolog protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
