C-5 sterol desaturase (ERG3) Recombinant Protein | ERG3 recombinant protein
Recombinant Saccharomyces cerevisiae C-5 sterol desaturase (ERG3)
Gene Names
ERG3; PSO6; SYR1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-5 sterol desaturase (ERG3); Recombinant Saccharomyces cerevisiae C-5 sterol desaturase (ERG3); Recombinant C-5 sterol desaturase (ERG3); C-5 sterol desaturase EC= 1.3.3.-; Ergosterol Delta(5; 6) desaturase Sterol-C5-desaturase; ERG3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-365
Sequence
MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQETLNSKNAVKECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIVTIFGLLLYLFTASLSYVFVFDKSIFNHPRYLKNQMAMEIKLAVSAIPWMSMLTVPWFVMELNGHSKLYMKIDYENHGVRKLIIEYFTFIFFTDCGVYLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSISYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRRPDDSLFDPKLRDAKETWDAQVKEVEHFIKEVEGDDNDRIYENDPNTKKNN
Sequence Length
365
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,730 Da
NCBI Official Full Name
Erg3p
NCBI Official Symbol
ERG3
NCBI Official Synonym Symbols
PSO6; SYR1
NCBI Protein Information
Erg3p
UniProt Protein Name
C-5 sterol desaturase
Protein Family
UniProt Gene Name
ERG3
UniProt Synonym Gene Names
PSO6; SYR1
UniProt Entry Name
ERG3_YEAST
Uniprot Description
Function: Catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. May contribute to the regulation of ergosterol biosynthesis.
Cofactor: Iron
By similarity.
Pathway: Steroid metabolism; ergosterol biosynthesis; ergosterol from zymosterol: step 3/5.
Subunit structure: Interacts with ERG28. Ref.9
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein
Probable.
Domain: The histidine box domains may contain the active site and/or be involved in metal ion binding.
Miscellaneous: Present with 36200 molecules/cell in log phase SD medium.
Sequence similarities: Belongs to the sterol desaturase family.
Similar Products
Product Notes
The ERG3 erg3 (Catalog #AAA1117318) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-365. The amino acid sequence is listed below: MDLVLEVADH YVLDDLYAKV LPASLAANIP VKWQKLLGLN SGFSNSTILQ ETLNSKNAVK ECRRFYGQVP FLFDMSTTSF ASLLPRSSIL REFLSLWVIV TIFGLLLYLF TASLSYVFVF DKSIFNHPRY LKNQMAMEIK LAVSAIPWMS MLTVPWFVME LNGHSKLYMK IDYENHGVRK LIIEYFTFIF FTDCGVYLAH RWLHWPRVYR ALHKPHHKWL VCTPFASHSF HPVDGFLQSI SYHIYPLILP LHKVSYLILF TFVNFWTVMI HDGQYLSNNP AVNGTACHTV HHLYFNYNYG QFTTLWDRLG GSYRRPDDSL FDPKLRDAKE TWDAQVKEVE HFIKEVEGDD NDRIYENDPN TKKNN. It is sometimes possible for the material contained within the vial of "C-5 sterol desaturase (ERG3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
