DNA repair endonuclease XPF (ERCC4) Recombinant Protein | ERCC4 recombinant protein
Recombinant Human DNA repair endonuclease XPF (ERCC4) , partial
Gene Names
ERCC4; XPF; RAD1; FANCQ; XFEPS; ERCC11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA repair endonuclease XPF (ERCC4); Recombinant Human DNA repair endonuclease XPF (ERCC4); partial; ERCC4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
658-916; Fragment at the C-terminal.
Sequence
RGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEISSNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Sequence Length
916
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,745 Da
NCBI Official Full Name
DNA repair endonuclease XPF
NCBI Official Synonym Full Names
ERCC excision repair 4, endonuclease catalytic subunit
NCBI Official Symbol
ERCC4
NCBI Official Synonym Symbols
XPF; RAD1; FANCQ; XFEPS; ERCC11
NCBI Protein Information
DNA repair endonuclease XPF
UniProt Protein Name
DNA repair endonuclease XPF
Protein Family
UniProt Gene Name
ERCC4
UniProt Synonym Gene Names
ERCC11; XPF
NCBI Description
The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause of xeroderma pigmentosum complementation group F (XP-F), or xeroderma pigmentosum VI (XP6).[provided by RefSeq, Mar 2009]
Uniprot Description
Catalytic component of a structure-specific DNA repair endonuclease responsible for the 5-prime incision during DNA repair. Involved in homologous recombination that assists in removing interstrand cross-link.
Research Articles on ERCC4
Similar Products
Product Notes
The ERCC4 ercc4 (Catalog #AAA1342034) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 658-916; Fragment at the C-terminal. The amino acid sequence is listed below: RGTASADVST DTRKAGGQEQ NGTQQSIVVD MREFRSELPS LIHRRGIDIE PVTLEVGDYI LTPEMCVERK SISDLIGSLN NGRLYSQCIS MSRYYKRPVL LIEFDPSKPF SLTSRGALFQ EISSNDISSK LTLLTLHFPR LRILWCPSPH ATAELFEELK QSKPQPDAAT ALAITADSET LPESEKYNPG PQDFLLKMPG VNAKNCRSLM HHVKNIAELA ALSQDELTSI LGNAANAKQL YDFIHTSFAE VVSKGKGKK . It is sometimes possible for the material contained within the vial of "DNA repair endonuclease XPF (ERCC4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
