Putative tyrosine-protein kinase epsB (epsB) Recombinant Protein | epsB recombinant protein
Recombinant Ralstonia solanacearum Putative tyrosine-protein kinase epsB (epsB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative tyrosine-protein kinase epsB (epsB); Recombinant Ralstonia solanacearum Putative tyrosine-protein kinase epsB (epsB); epsB recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-751aa; full length protein
Sequence
MTQNLSQPPAVNAPESELDLVRYLDVLVANRWLIAGIAAVVMLLGATYAFLARPVYEADV LVQVEDNPNSAKSLLGDVSSLFDVKTDANAEIEILRSRMVVGKAVDNLHLYITAKPHYFP LIGAWVASRAKQLSEPGLFGLGGYTWGTELIDVDGFDVPEALEGQPFKLTALGNGRYRLE NKSLDTPIEGVVGEPLEAKQSVGTIQLLVNTLAAKAGAAFELQRDSRLKTLEMLQDKLKI SEKGKQSGIIGASLEGKNPALTAAIMNQIATEYVAQNIKRKAEEAERSLVFLDGLLPQLK LQLERAEMKYNEMRNLRGTFDLSEEGKAFLQESVTTETSLQELKQKRAELLTRFTASHPG VQAIDQQIAVMSGKVGAMTRRLKSLPNIEQDTVRLMRDVQVDNDLYVSLLNDMQQLKLVK AGKVGNVRLVDGAAVPEEPVKPKKLTVTALAGVLGVVLGVVAAFVRNTLFGGITEPQDIE EHTGLSVYATVPLSDVQIDLSSQLTTHKRGQYLLARRVPDDPSIESLRSLRTALQFAMQD SGNNLVVLTGPTPGVGKSFVSANLAAVIATGGKRVLLVDADMRKGYLHQYFGKDRKPGLL DLLAGDRSIEQVVHREVVPGLDFIATGLFPHNPSELLLNPRMVELMDTFRAQYDLVLIDT PPVLAVTDTAILAARAGTVLMVTRFERSTLGEIRETIKQLQHANVEVRGVVFNALDPNTY RYGYGSRYGRYRYVQYGYTSKPSAEAEAESA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for epsB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,176 Da
NCBI Official Full Name
tyrosine protein kinase
NCBI Official Symbol
RS_RS22035
NCBI Protein Information
tyrosine protein kinase
UniProt Protein Name
Putative tyrosine-protein kinase EpsB
Protein Family
UniProt Gene Name
epsB
UniProt Entry Name
EPSB_RALSO
Uniprot Description
Probably involved in polymerization and/or export of exopolysaccharide EPS I which functions as a virulence factor. May be involved in an ATP-dependent process in the pathway for EPS I production, possibly export of the trimeric repeat units across the inner membrane or their polymerization ().
Similar Products
Product Notes
The epsB epsb (Catalog #AAA7014295) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-751aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the epsB epsb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTQNLSQPPA VNAPESELDL VRYLDVLVAN RWLIAGIAAV VMLLGATYAF LARPVYEADV LVQVEDNPNS AKSLLGDVSS LFDVKTDANA EIEILRSRMV VGKAVDNLHL YITAKPHYFP LIGAWVASRA KQLSEPGLFG LGGYTWGTEL IDVDGFDVPE ALEGQPFKLT ALGNGRYRLE NKSLDTPIEG VVGEPLEAKQ SVGTIQLLVN TLAAKAGAAF ELQRDSRLKT LEMLQDKLKI SEKGKQSGII GASLEGKNPA LTAAIMNQIA TEYVAQNIKR KAEEAERSLV FLDGLLPQLK LQLERAEMKY NEMRNLRGTF DLSEEGKAFL QESVTTETSL QELKQKRAEL LTRFTASHPG VQAIDQQIAV MSGKVGAMTR RLKSLPNIEQ DTVRLMRDVQ VDNDLYVSLL NDMQQLKLVK AGKVGNVRLV DGAAVPEEPV KPKKLTVTAL AGVLGVVLGV VAAFVRNTLF GGITEPQDIE EHTGLSVYAT VPLSDVQIDL SSQLTTHKRG QYLLARRVPD DPSIESLRSL RTALQFAMQD SGNNLVVLTG PTPGVGKSFV SANLAAVIAT GGKRVLLVDA DMRKGYLHQY FGKDRKPGLL DLLAGDRSIE QVVHREVVPG LDFIATGLFP HNPSELLLNP RMVELMDTFR AQYDLVLIDT PPVLAVTDTA ILAARAGTVL MVTRFERSTL GEIRETIKQL QHANVEVRGV VFNALDPNTY RYGYGSRYGR YRYVQYGYTS KPSAEAEAES A. It is sometimes possible for the material contained within the vial of "Putative tyrosine-protein kinase epsB (epsB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
