Epididymis protein 4 Recombinant Protein | HE4 recombinant protein

Recombinant Human Epididymis protein 4 (HE4)

Cat. Num. AAA283702

• Purity: > 90 % as determined by SDS-PAGE.
• Synonyms: Epididymis protein 4; Recombinant Human Epididymis protein 4 (HE4); WFDC2; WAP5; EDDM4; Epididymal Protein 4; Epididymal Secretory Protein E4; Putative Protease Inhibitor WAP5; Major epididymis-specific protein E4.; HE4 recombinant protein

• Host: E. coli AA 21-124 (Q14508).
• Purity/Purification: > 90 % as determined by SDS-PAGE.
• Form/Format: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, 300 mM Imidazole, pH 8.0,with 15% glycerol.
• Concentration: 1.5 mg/mL (varies by lot)

• Source: Human
• Protein residues: with N-terminal 6×His-tag.
• Protein sequences: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSL PNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
• [Predicted molecular mass]: Predicted MW: 17 kDa ; Observed MW: 17 kDa
• Endotoxin level: Please contact us for more information.
• USAGE: HE4 Protein-Centrifuge the standard vial at 6000-1000rpm for 30s.
• Preparation and Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. ; ; Avoid repeated freeze-thaw cycles.; ; The recombinant protein is stable for up to 6 months from date of receipt at -80°C .

SDS-PAGE

Related Product Information for HE4 recombinant protein

WAP four-disulfide core domain protein 2 - also known as Human EpididymisProtein 4 (HE4), is a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis.