Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein EPIDERMAL PATTERNING FACTOR 2 (EPF2) Recombinant Protein | EPF2 recombinant protein

Recombinant Arabidopsis thaliana Protein EPIDERMAL PATTERNING FACTOR 2 (EPF2)

Gene Names
EPF2; EPIDERMAL PATTERNING FACTOR 2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein EPIDERMAL PATTERNING FACTOR 2 (EPF2); Recombinant Arabidopsis thaliana Protein EPIDERMAL PATTERNING FACTOR 2 (EPF2); EPF2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-120, Full length protein
Sequence
IRTPPLKNTVNGGEKKNADIEQAQTHHKKEISKNGGVEMEMYPTGSSLPDCSYACGACSPCKRVMISFECSVAESCSVIYRCTCRGRYYHVPSRA
Sequence Length
95
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,317 Da
NCBI Official Full Name
Putative membrane lipoprotein
NCBI Official Symbol
EPF2
NCBI Official Synonym Symbols
EPIDERMAL PATTERNING FACTOR 2
NCBI Protein Information
Putative membrane lipoprotein
UniProt Protein Name
Protein EPIDERMAL PATTERNING FACTOR 2
UniProt Gene Name
EPF2

NCBI Description

Encodes a secretory peptide EPF2 expressed in proliferating cells of the stomatal lineage, known as meristemoids, and in guard mother cells, the progenitors of stomata. Controls asymmetric cell divisions during stomatal development. EPF2 is related to EPF1, also involved in stomatal development. Its transcript levels change after inducing MUTE expression in a mute background.

Uniprot Description

Controls stomatal patterning. Regulates the number of cells that enter, and remain in, the stomatal lineage by inhibiting protodermal cells from adopting the meristemoid mother cell (MMC) fate in a non-cell-autonomous manner. Mediates stomatal development inhibition. MEPF2: mobile signal controlling stomatal development in a non-cell-autonomous manner (PubMed:22241782). Uses ERECTA as major receptor (PubMed:22241782). Inactivated by cleavage by CRSP (AC Q9LNU1) (PubMed:25043023). May act by competing with somatogen (AC Q9SV72) for the same receptor, TMM (AC Q9SSD1) (PubMed:22027592).

Research Articles on EPF2

Similar Products

Product Notes

The EPF2 epf2 (Catalog #AAA1423754) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-120, Full length protein. The amino acid sequence is listed below: IRTPPLKNTV NGGEKKNADI EQAQTHHKKE ISKNGGVEME MYPTGSSLPD CSYACGACSP CKRVMISFEC SVAESCSVIY RCTCRGRYYH VPSRA. It is sometimes possible for the material contained within the vial of "Protein EPIDERMAL PATTERNING FACTOR 2 (EPF2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.