Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Endothelial PAS domain-containing protein 1 Recombinant Protein | EPAS1 recombinant protein

Endothelial PAS domain-containing protein 1

Gene Names
EPAS1; HLF; MOP2; ECYT4; HIF2A; PASD2; bHLHe73
Applications
ELISA, Western Blot
Purity
>95% by SDS-PAGE
Synonyms
Endothelial PAS domain-containing protein 1; BHLHE73; HIF2A; MOP2; PASD2; Basic-helix-loop-helix-PAS protein MOP2; Class E basic helix-loop-helix protein 73; HIF-1-alpha-like factor; Hypoxia-inducible factor 2-alpha; Member of PAS protein 2; PAS domain-containing protein 2; bHLHe73; HLF; HIF-2-alpha; EPAS1 recombinant protein
Ordering
Host
E Coli
Purity/Purification
>95% by SDS-PAGE
Form/Format
Liquid
Sequence
NTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT
Sequence Length
870
Applicable Applications for EPAS1 recombinant protein
ELISA (EIA), Western Blot (WB), Affinity Purification (AP)
Species
Human
Tags
His
Storage Buffer
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Preparation and Storage
Store at -20 degree C.
Avoid repeated freezing and thawing.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96,459 Da
NCBI Official Full Name
endothelial PAS domain-containing protein 1
NCBI Official Synonym Full Names
endothelial PAS domain protein 1
NCBI Official Symbol
EPAS1
NCBI Official Synonym Symbols
HLF; MOP2; ECYT4; HIF2A; PASD2; bHLHe73
NCBI Protein Information
endothelial PAS domain-containing protein 1
UniProt Protein Name
Endothelial PAS domain-containing protein 1
UniProt Gene Name
EPAS1
UniProt Synonym Gene Names
BHLHE73; HIF2A; MOP2; PASD2; EPAS-1; bHLHe73; HLF; HIF-2-alpha; HIF2-alpha

NCBI Description

This gene encodes a transcription factor involved in the induction of genes regulated by oxygen, which is induced as oxygen levels fall. The encoded protein contains a basic-helix-loop-helix domain protein dimerization domain as well as a domain found in proteins in signal transduction pathways which respond to oxygen levels. Mutations in this gene are associated with erythrocytosis familial type 4. [provided by RefSeq, Nov 2009]

Uniprot Description

Transcription factor involved in the induction of oxygen regulated genes. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. May also play a role in the formation of the endothelium that gives rise to the blood brain barrier. Potent activator of the Tie-2 tyrosine kinase expression. Activation seems to require recruitment of transcriptional coactivators such as CREBBP and probably EP300. Interaction with redox regulatory protein APEX seems to activate CTAD.

Research Articles on EPAS1

Similar Products

Product Notes

The EPAS1 epas1 (Catalog #AAA2889423) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Endothelial PAS domain-containing protein 1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Affinity Purification (AP). Researchers should empirically determine the suitability of the EPAS1 epas1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NTQWPPDPPL HFGPTKWAVG DQRTEFLGAA PLGPPVSPPH VSTFKTRSAK GFGARGPDVL SPAMVALSNK LKLKRQLEYE EQAFQDLSGG DPPGGSTSHL MWKRMKNLRG GSCPLMPDKP LSANVPNDKF TQNPMRGLGH PLRHLPLPQP PSAISPGENS KSRFPPQCYA TQYQDYSLSS AHKVSGMASR LLGPSFESYL LPELTRYDCE VNVPVLGSST LLQGGDLLRA LDQAT. It is sometimes possible for the material contained within the vial of "Endothelial PAS domain-containing protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.