Enterotoxin type B Recombinant Protein | entB recombinant protein

Recombinant Staphylococcus aureus Enterotoxin type B (entB)

Cat. Num. AAA969663

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Enterotoxin type B; Recombinant Staphylococcus aureus Enterotoxin type B (entB); SEB; entB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 28-266aa; Full Length of Mature Protein
• Sequence: ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

• Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for entB recombinant protein

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

References

Nucleotide sequence of the enterotoxin B gene from Staphylococcus aureus.Jones C.L., Khan S.A.J. Bacteriol. 166:29-33(1986) Molecular cloning of staphylococcal enterotoxin B gene in Escherichia coli and Staphylococcus aureus.Ranelli D.M., Jones C.L., Johns M.B., Mussey G.J., Khan S.A.Proc. Natl. Acad. Sci. U.S.A. 82:5850-5854(1985) The primary structure of staphylococcal enterotoxin B. 3. The cyanogen bromide peptides of reduced and aminoethylated enterotoxin B, and the complete amino acid sequence.Huang I.-Y., Bergdoll M.S.J. Biol. Chem. 245:3518-3525(1970) Crystal structure of staphylococcal enterotoxin B, a superantigen.Swaminathan S., Furey W.F. Jr., Pletcher J., Sax M.Nature 359:801-806(1992) Three-dimensional structure of a human class II histocompatibility molecule complexed with superantigen.Jardetzky T.S., Brown J.H., Gorga J.C., Stern L.J., Urban R.G., Chi Y.I., Stauffacher C., Strominger J.L., Wiley D.C.Nature 368:711-718(1994) Three-dimensional structure of the complex between a T cell receptor beta chain and the superantigen staphylococcal enterotoxin B.Li H., Llera A., Tsuchiya D., Leder L., Ysern X., Schlievert P.M., Karjalainen K., Mariuzza R.A.Immunity 9:807-816(1998) Crystal structure of microbial superantigen staphylococcal enterotoxin B at 1.5-A resolution implications for superantigen recognition by MHC class II molecules and T-cell receptors.Papageorgiou A.C., Tranter H.S., Acharya K.R.J. Mol. Biol. 277:61-79(1998)

NCBI and Uniprot Product Information

• NCBI GI #: 446200230
• NCBI Accession #: WP_000278085.1
• NCBI GenBank Nucleotide #: WP_000278085.1
• UniProt Accession #: P01552
• Molecular Weight: 30.4 kDa
• NCBI Official Full Name: enterotoxin
• UniProt Protein Name: Enterotoxin type B
• Protein Family: Enterotoxin
• UniProt Gene Name: entB
• UniProt Entry Name: ETXB_STAAU

Uniprot Description

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.