SDS-PAGE
ER membrane protein complex subunit 9 Recombinant Protein | EMC9 recombinant protein
Recombinant Human ER membrane protein complex subunit 9
Gene Names
EMC9; CGI-112; FAM158A; C14orf122
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ER membrane protein complex subunit 9; Recombinant Human ER membrane protein complex subunit 9; Protein FAM158A; EMC9 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-208aa; Full Length
Sequence
MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA
Sequence Length
208
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Product Categories/Family for EMC9 recombinant protein
References
Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.Genome Res. 10:703-713(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39.1 kDa
NCBI Official Full Name
ER membrane protein complex subunit 9
NCBI Official Synonym Full Names
ER membrane protein complex subunit 9
NCBI Official Symbol
EMC9
NCBI Official Synonym Symbols
CGI-112; FAM158A; C14orf122
NCBI Protein Information
ER membrane protein complex subunit 9
UniProt Protein Name
ER membrane protein complex subunit 9
Protein Family
UniProt Gene Name
EMC9
UniProt Synonym Gene Names
C14orf122; FAM158A
UniProt Entry Name
EMC9_HUMAN
Uniprot Description
FAM158A: Belongs to the EMC8/EMC9 family.
Chromosomal Location of Human Ortholog: 14q11.2
Cellular Component: cytoplasm
Molecular Function: protein binding
Similar Products
Product Notes
The EMC9 emc9 (Catalog #AAA1288987) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-208aa; Full Length. The amino acid sequence is listed below: MGEVEISALA YVKMCLHAAR YPHAAVNGLF LAPAPRSGEC LCLTDCVPLF HSHLALSVML EVALNQVDVW GAQAGLVVAG YYHANAAVND QSPGPLALKI AGRIAEFFPD AVLIMLDNQK LVPQPRVPPV IVLENQGLRW VPKDKNLVMW RDWEESRQMV GALLEDRAHQ HLVDFDCHLD DIRQDWTNQR LNTQITQWVG PTNGNGNA. It is sometimes possible for the material contained within the vial of "ER membrane protein complex subunit 9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
